Lineage for d1yred_ (1yre D:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. Protein automated matches [190241] (13 species)
    not a true protein
  7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [187674] (2 PDB entries)
  8. Domain d1yred_: 1yre D: [123922]
    Other proteins in same PDB: d1yrea1
    automated match to d1yrea1
    complexed with coa

Details for d1yred_

PDB Entry: 1yre (more details), 2.15 Å

PDB Description: hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa
PDB Compounds: (D:) hypothetical protein PA3270

SCOPe Domain Sequences for d1yred_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yred_ d.108.1.1 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
fkplpitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrqslaeqregr
alplavrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikylmlkhafdnl
rmvrvqlstaasnlraqgaidklgaqregvlrnhrrlaggrlddtfvysitdhewpqvka
aleasft

SCOPe Domain Coordinates for d1yred_ are not available.

Timeline for d1yred_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1yrea1, d1yreb_, d1yrec_