SCOPe 2.08: Domain d1yred_: 1yre D:

Lineage for d1yred_ (1yre D:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
   3 layers: a/b/a; contains mixed beta-sheet

4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families)

5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)

6. Protein automated matches [190241] (13 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [187674] (2 PDB entries)

8. Domain d1yred_: 1yre D: [123922]
   Other proteins in same PDB: d1yrea1
   automated match to d1yrea1
   complexed with coa

Details for d1yred_

PDB Entry: 1yre, 2.15 Å

PDB Description: hypothetical protein pa3270 from pseudomonas aeruginosa in complex with coa

PDB Compounds: (D:) hypothetical protein PA3270

SCOPe Domain Sequences for d1yred_:

Sequence; same for both SEQRES and ATOM records:

>d1yred_ d.108.1.1 (D:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
fkplpitlqrgalrleplveadipelvslaeanrealqymdgptrpdwyrqslaeqregr
alplavrlgvqlvgttrfaeflpalpaceigwtwldqaqhgsglnrmikylmlkhafdnl
rmvrvqlstaasnlraqgaidklgaqregvlrnhrrlaggrlddtfvysitdhewpqvka
aleasft

Timeline for d1yred_:

• d1yred_ first appeared in SCOP 1.73, called d1yred1
  
• d1yred_ appears in SCOPe 2.07