Lineage for d1yp6a1 (1yp6 A:1-157)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804246Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 2804247Superfamily b.60.1: Lipocalins [50814] (10 families) (S)
    bind hydrophobic ligands in their interior
  5. 2804248Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
    barrel, closed; n=8, S=12, meander
  6. 2804418Protein Major urinary protein/alpha-2u-globulin [50832] (2 species)
  7. 2804419Species Mouse (Mus musculus) [TaxId:10090] [50833] (19 PDB entries)
  8. 2804428Domain d1yp6a1: 1yp6 A:1-157 [123822]
    complexed with cd, cl, prz

Details for d1yp6a1

PDB Entry: 1yp6 (more details), 1.8 Å

PDB Description: van der waals interactions dominate hydrophobic association in a protein binding site occluded from solvent water
PDB Compounds: (A:) major urinary protein 1

SCOPe Domain Sequences for d1yp6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yp6a1 b.60.1.1 (A:1-157) Major urinary protein/alpha-2u-globulin {Mouse (Mus musculus) [TaxId: 10090]}
eeasstgrnfnvekingewhtiilasdkrekiedngnfrlfleqihvlekslvlkfhtvr
deecselsmvadktekageysvtydgfntftipktdydnflmahlinekdgetfqlmglf
grepdlssdikerfaqlceehgilreniidlsnanrc

SCOPe Domain Coordinates for d1yp6a1:

Click to download the PDB-style file with coordinates for d1yp6a1.
(The format of our PDB-style files is described here.)

Timeline for d1yp6a1: