![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
![]() | Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families) ![]() superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands |
![]() | Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins) this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain |
![]() | Protein Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain [141579] (1 species) |
![]() | Species Potato (Solanum tuberosum) [TaxId:4113] [141580] (3 PDB entries) Uniprot P23509 387-521 |
![]() | Domain d1yp2d1: 1yp2 D:317-451 [123804] Other proteins in same PDB: d1yp2a2, d1yp2b2, d1yp2c2, d1yp2d2 automated match to d1yp2a1 complexed with pmb, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1yp2 (more details), 2.11 Å
SCOPe Domain Sequences for d1yp2d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yp2d1 b.81.1.4 (D:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]} ylppskmldadvtdsvigegcviknckihhsvvglrscisegaiiedsllmgadyyetda drkllaakgsvpigigknchikraiidknarigdnvkiinkdnvqeaaretdgyfiksgi vtvikdalipsgiii
Timeline for d1yp2d1: