PDB entry 1yp2

View 1yp2 on RCSB PDB site
Description: Crystal structure of potato tuber ADP-glucose pyrophosphorylase
Class: transferase
Keywords: ADP-glucose synthase, ADP-glucose pyrophosphorylase, AGPASE B, Alpha-D-glucose-1-phosphate adenyl transferase
Deposited on 2005-01-29, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.172
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-1-phosphate adenylyltransferase small subunit
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yp2a1, d1yp2a2
  • Chain 'B':
    Compound: Glucose-1-phosphate adenylyltransferase small subunit
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yp2b1, d1yp2b2
  • Chain 'C':
    Compound: Glucose-1-phosphate adenylyltransferase small subunit
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yp2c1, d1yp2c2
  • Chain 'D':
    Compound: Glucose-1-phosphate adenylyltransferase small subunit
    Species: Solanum tuberosum [TaxId:4113]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yp2d1, d1yp2d2
  • Heterogens: SO4, PMB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yp2A (A:)
    mavsdsqnsqtcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvs
    nclnsniskiyvltqfnsaslnrhlsrayasnmggyknegfvevlaaqqspenpdwfqgt
    adavrqylwlfeehtvleylilagdhlyrmdyekfiqahretdaditvaalpmdekrata
    fglmkideegriiefaekpqgeqlqamkvdttilglddkrakempfiasmgiyviskdvm
    lnllrdkfpgandfgsevipgatslgmrvqaylydgywedigtieafynanlgitkkpvp
    dfsfydrsapiytqprylppskmldadvtdsvigegcviknckihhsvvglrscisegai
    iedsllmgadyyetdadrkllaakgsvpigigknchikraiidknarigdnvkiinkdnv
    qeaaretdgyfiksgivtvikdalipsgiii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yp2A (A:)
    qtcldpdasrsvlgiilrlypltkkrakpavplganyrlidipvsnclnsniskiyvltq
    fnsaslnrhlsrayaegfvevlaaqqspenpdwfqgtadavrqylwlfeehtvleylila
    gdhlyrmdyekfiqahretdaditvaalpmdekratafglmkideegriiefaekpqgeq
    lqamkvdttilglddkrakempfiasmgiyviskdvmlnllrdkfpgandfgsevipgat
    slgmrvqaylydgywedigtieafynanlgitkkpvpdfsfydrsapiytqprylppskm
    ldadvtdsvigegcviknckihhsvvglrscisegaiiedsllmgadyyetdadrkllaa
    kgsvpigigknchikraiidknarigdnvkiinkdnvqeaaretdgyfiksgivtvikda
    lipsgiii
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yp2B (B:)
    mavsdsqnsqtcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvs
    nclnsniskiyvltqfnsaslnrhlsrayasnmggyknegfvevlaaqqspenpdwfqgt
    adavrqylwlfeehtvleylilagdhlyrmdyekfiqahretdaditvaalpmdekrata
    fglmkideegriiefaekpqgeqlqamkvdttilglddkrakempfiasmgiyviskdvm
    lnllrdkfpgandfgsevipgatslgmrvqaylydgywedigtieafynanlgitkkpvp
    dfsfydrsapiytqprylppskmldadvtdsvigegcviknckihhsvvglrscisegai
    iedsllmgadyyetdadrkllaakgsvpigigknchikraiidknarigdnvkiinkdnv
    qeaaretdgyfiksgivtvikdalipsgiii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yp2B (B:)
    tcldpdasrsvlgiiltrlypltkkrakpavplganyrlidipvsnclnsniskiyvltq
    fnsaslnrhlsrayasnegfvevlaaqqspefqgtadavrqylwlfeehtvleylilagd
    hlyrmdyekfiqahretdaditvaalpmdekratafglmkideegriiefaekpqgeqlq
    amkvdttilglddkrakempfiasmgiyviskdvmlnllrdkfpgandfgsevipgatsl
    gmrvqaylydgywedigtieafynanlgitkkpvpdfsfydrsapiytqprylppskmld
    advtdsvigegcviknckihhsvvglrscisegaiiedsllmgadyyetdadrkllaakg
    svpigigknchikraiidknarigdnvkiinkdnvqeaaretdgyfiksgivtvikdali
    psgiii
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yp2C (C:)
    mavsdsqnsqtcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvs
    nclnsniskiyvltqfnsaslnrhlsrayasnmggyknegfvevlaaqqspenpdwfqgt
    adavrqylwlfeehtvleylilagdhlyrmdyekfiqahretdaditvaalpmdekrata
    fglmkideegriiefaekpqgeqlqamkvdttilglddkrakempfiasmgiyviskdvm
    lnllrdkfpgandfgsevipgatslgmrvqaylydgywedigtieafynanlgitkkpvp
    dfsfydrsapiytqprylppskmldadvtdsvigegcviknckihhsvvglrscisegai
    iedsllmgadyyetdadrkllaakgsvpigigknchikraiidknarigdnvkiinkdnv
    qeaaretdgyfiksgivtvikdalipsgiii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yp2C (C:)
    qtcldpdasrsvlgiilggtrlypltkkrakpavplganyrlidipvsnclnsniskiyv
    ltqfnsaslnrhlsrayasegfvevlaaqqspenpdwfqgtadavrqylwlfeehtvley
    lilagdhlyrmdyekfiqahretdaditvaalpmdekratafglmkideegriiefaekp
    qgeqlqamkvdttilglddkrakempfiasmgiyviskdvmlnllrdkfpgandfgsevi
    pgatslgmrvqaylydgywedigtieafynanlgitkkpvpdfsfydrsapiytqprylp
    pskmldadvtdsvigegcviknckihhsvvglrscisegaiiedsllmgadyyetdadrk
    llaakgsvpigigknchikraiidknarigdnvkiinkdnvqeaaretdgyfiksgivtv
    ikdalipsgiii
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yp2D (D:)
    mavsdsqnsqtcldpdasrsvlgiilgggagtrlypltkkrakpavplganyrlidipvs
    nclnsniskiyvltqfnsaslnrhlsrayasnmggyknegfvevlaaqqspenpdwfqgt
    adavrqylwlfeehtvleylilagdhlyrmdyekfiqahretdaditvaalpmdekrata
    fglmkideegriiefaekpqgeqlqamkvdttilglddkrakempfiasmgiyviskdvm
    lnllrdkfpgandfgsevipgatslgmrvqaylydgywedigtieafynanlgitkkpvp
    dfsfydrsapiytqprylppskmldadvtdsvigegcviknckihhsvvglrscisegai
    iedsllmgadyyetdadrkllaakgsvpigigknchikraiidknarigdnvkiinkdnv
    qeaaretdgyfiksgivtvikdalipsgiii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yp2D (D:)
    tcldpdasrsvlgiiltrlypltkkrakpavplganyrlidipvsnclnsniskiyvltq
    fnsaslnrhlsraynegfvevlaaqqspfqgtadavrqylwlfeehtvleylilagdhly
    rmdyekfiqahretdaditvaalpmdekratafglmkideegriiefaekpqgeqlqamk
    vdttilglddkrakempfiasmgiyviskdvmlnllrdkfpgandfgsevipgatslgmr
    vqaylydgywedigtieafynanlgitkkpvpdfsfydrsapiytqprylppskmldadv
    tdsvigegcviknckihhsvvglrscisegaiiedsllmgadyyetdadrkllaakgsvp
    igigknchikraiidknarigdnvkiinkdnvqeaaretdgyfiksgivtvikdalipsg
    iii