SCOPe 2.08: Domain d1yp2a1: 1yp2 A:317-451

Lineage for d1yp2a1 (1yp2 A:317-451)

Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds)
Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
superhelix turns are made of parallel beta-strands and (short) turns
Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands
Family b.81.1.4: GlmU C-terminal domain-like [51171] (4 proteins)
this is a repeat family; one repeat unit is 2oi5 A:321-339 found in domain
Protein Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain [141579] (1 species)
Species Potato (Solanum tuberosum) [TaxId:4113] [141580] (3 PDB entries)
Uniprot P23509 387-521
Domain d1yp2a1: 1yp2 A:317-451 [123798]
Other proteins in same PDB: d1yp2a2, d1yp2b2, d1yp2c2, d1yp2d2
complexed with pmb, so4
has additional insertions and/or extensions that are not grouped together

Details for d1yp2a1

PDB Entry: 1yp2 (more details), 2.11 Å

PDB Description: Crystal structure of potato tuber ADP-glucose pyrophosphorylase

PDB Compounds: (A:) Glucose-1-phosphate adenylyltransferase small subunit

SCOPe Domain Sequences for d1yp2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yp2a1 b.81.1.4 (A:317-451) Glucose-1-phosphate adenylyltransferase small subunit, C-terminal domain {Potato (Solanum tuberosum) [TaxId: 4113]}
ylppskmldadvtdsvigegcviknckihhsvvglrscisegaiiedsllmgadyyetda
drkllaakgsvpigigknchikraiidknarigdnvkiinkdnvqeaaretdgyfiksgi
vtvikdalipsgiii

SCOPe Domain Coordinates for d1yp2a1:

Click to download the PDB-style file with coordinates for d1yp2a1.
(The format of our PDB-style files is described here.)

Timeline for d1yp2a1: