![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.5: TRAP-like [51219] (2 families) ![]() shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains |
![]() | Family b.82.5.2: PA3696/SPS0176-like [101995] (2 proteins) duplication: there are three structural repeats per subunit; nine domains per ring-like trimer automatically mapped to Pfam PF01987 |
![]() | Protein Hypothetical protein PA3696 [141645] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [141646] (1 PDB entry) Uniprot Q9HXU4 5-244 |
![]() | Domain d1yoxe2: 1yox E:4-237 [123793] Other proteins in same PDB: d1yoxb3, d1yoxd3, d1yoxe3 automated match to d1yoxa1 |
PDB Entry: 1yox (more details), 2.3 Å
SCOPe Domain Sequences for d1yoxe2:
Sequence, based on SEQRES records: (download)
>d1yoxe2 b.82.5.2 (E:4-237) Hypothetical protein PA3696 {Pseudomonas aeruginosa [TaxId: 287]} heldyrilgesmqtveieldpgetviaeagamnymtgdirftarmgdgsdgsllgklwsa gkrklggesvfmthftnegqgkqhvafaapypgsvvavdlddvggrlfcqkdsflcaayg trvgiaftkrlgagffggegfilqklegdglvfvhaggtlirrqlngetlrvdtgclvaf tdgidydvqlagglksmlfggeglllttlkgsgtvwlqslpfsrlagriydatf
>d1yoxe2 b.82.5.2 (E:4-237) Hypothetical protein PA3696 {Pseudomonas aeruginosa [TaxId: 287]} heldyrilgesmqtveieldpgetviaeagamnymtgdirftarmgsvfmthftnegqgk qhvafaapypgsvvavdlddvggrlfcqkdsflcaaygtrvgiaftkrlgagffggegfi lqklegdglvfvhaggtlirrqlngetlrvdtgclvaftdgidydvqlaeglllttlkgs gtvwlqslpfsrlagriydatf
Timeline for d1yoxe2: