Lineage for d1yoxb2 (1yox B:4-237)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2405860Superfamily b.82.5: TRAP-like [51219] (2 families) (S)
    shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains
  5. 2406096Family b.82.5.2: PA3696/SPS0176-like [101995] (2 protein domains)
    duplication: there are three structural repeats per subunit; nine domains per ring-like trimer
    automatically mapped to Pfam PF01987
  6. 2406097Protein Hypothetical protein PA3696 [141645] (1 species)
  7. 2406098Species Pseudomonas aeruginosa [TaxId:287] [141646] (1 PDB entry)
    Uniprot Q9HXU4 5-244
  8. 2406100Domain d1yoxb2: 1yox B:4-237 [123790]
    Other proteins in same PDB: d1yoxb3, d1yoxd3, d1yoxe3
    automated match to d1yoxa1

Details for d1yoxb2

PDB Entry: 1yox (more details), 2.3 Å

PDB Description: structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa
PDB Compounds: (B:) hypothetical protein PA3696

SCOPe Domain Sequences for d1yoxb2:

Sequence, based on SEQRES records: (download)

>d1yoxb2 b.82.5.2 (B:4-237) Hypothetical protein PA3696 {Pseudomonas aeruginosa [TaxId: 287]}
heldyrilgesmqtveieldpgetviaeagamnymtgdirftarmgdgsdgsllgklwsa
gkrklggesvfmthftnegqgkqhvafaapypgsvvavdlddvggrlfcqkdsflcaayg
trvgiaftkrlgagffggegfilqklegdglvfvhaggtlirrqlngetlrvdtgclvaf
tdgidydvqlagglksmlfggeglllttlkgsgtvwlqslpfsrlagriydatf

Sequence, based on observed residues (ATOM records): (download)

>d1yoxb2 b.82.5.2 (B:4-237) Hypothetical protein PA3696 {Pseudomonas aeruginosa [TaxId: 287]}
heldyrilgesmqtveieldpgetviaeagamnymtgdirftarmthftnegqgkqhvaf
aapypgsvvavdlddvggrlfcqkdsflcaaygtrvgiaftkrlgfilqklegdglvfvh
aggtlirrqlngetlrvdtgclvaftdgidydvqlaggggeglllttlkgsgtvwlqslp
fsrlagriydatf

SCOPe Domain Coordinates for d1yoxb2:

Click to download the PDB-style file with coordinates for d1yoxb2.
(The format of our PDB-style files is described here.)

Timeline for d1yoxb2: