SCOPe 2.08: Domain d1yoxc_: 1yox C:

Lineage for d1yoxc_ (1yox C:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.5: TRAP-like [51219] (2 families)
   shorter variant of double-helix; assembles in large ring-like structures containing from 9 to 11 domains

5. Family b.82.5.2: PA3696/SPS0176-like [101995] (2 proteins)
   duplication: there are three structural repeats per subunit; nine domains per ring-like trimer
   automatically mapped to Pfam PF01987

6. Protein Hypothetical protein PA3696 [141645] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141646] (1 PDB entry)
   Uniprot Q9HXU4 5-244

8. Domain d1yoxc_: 1yox C: [123791]
   Other proteins in same PDB: d1yoxb3, d1yoxd3, d1yoxe3
   automated match to d1yoxa1

Details for d1yoxc_

PDB Entry: 1yox, 2.3 Å

PDB Description: structure of the conserved protein of unknown function pa3696 from pseudomonas aeruginosa

PDB Compounds: (C:) hypothetical protein PA3696

SCOPe Domain Sequences for d1yoxc_:

Sequence, based on SEQRES records:

>d1yoxc_ b.82.5.2 (C:) Hypothetical protein PA3696 {Pseudomonas aeruginosa [TaxId: 287]}
eldyrilgesmqtveieldpgetviaeagamnymtgdirftarmgdgsdgsllgklwsag
krklggesvfmthftnegqgkqhvafaapypgsvvavdlddvggrlfcqkdsflcaaygt
rvgiaftkrlgagffggegfilqklegdglvfvhaggtlirrqlngetlrvdtgclvaft
dgidydvqlagglksmlfggeglllttlkgsgtvwlqslpfsrlagriydatf

Sequence, based on observed residues (ATOM records):

>d1yoxc_ b.82.5.2 (C:) Hypothetical protein PA3696 {Pseudomonas aeruginosa [TaxId: 287]}
eldyrilgesmqtveieldpgetviaeagamnymtgdirftarmthftnegqgkqhvafa
apypgsvvavdlddvggrlfcqkdsflcaaygtrvgiaftkrlgagffggegfilqkleg
dglvfvhaggtlirrqlngetlrvdtgclvaftdgidydvqlagglllttlkgsgtvwlq
slpfsrlagriydatf

Timeline for d1yoxc_:

• d1yoxc_ first appeared in SCOP 1.73, called d1yoxc1
  
• d1yoxc_ appears in SCOPe 2.07