PDB entry 1yox

View 1yox on RCSB PDB site
Description: Structure of the conserved Protein of Unknown Function PA3696 from Pseudomonas aeruginosa
Class: structural genomics, unknown function
Keywords: structural genomics; psi, protein structure initiative, midwest center for structural genomics, mcsg, structural genomics, unknown function
Deposited on 2005-01-28, released 2005-04-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA3696
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA3696
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HXU4
      • modified residue (16)
      • modified residue (36)
      • modified residue (39)
      • modified residue (76)
    Domains in SCOPe 2.07: d1yoxa1
  • Chain 'B':
    Compound: hypothetical protein PA3696
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA3696
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HXU4
      • modified residue (16)
      • modified residue (36)
      • modified residue (39)
      • modified residue (76)
    Domains in SCOPe 2.07: d1yoxb2, d1yoxb3
  • Chain 'C':
    Compound: hypothetical protein PA3696
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA3696
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HXU4
      • modified residue (16)
      • modified residue (36)
      • modified residue (39)
      • modified residue (76)
    Domains in SCOPe 2.07: d1yoxc_
  • Chain 'D':
    Compound: hypothetical protein PA3696
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA3696
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HXU4
      • modified residue (16)
      • modified residue (36)
      • modified residue (39)
      • modified residue (76)
      • modified residue (201)
    Domains in SCOPe 2.07: d1yoxd2, d1yoxd3
  • Chain 'E':
    Compound: hypothetical protein PA3696
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA3696
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HXU4
      • modified residue (16)
      • modified residue (36)
      • modified residue (39)
      • modified residue (49)
      • modified residue (76)
    Domains in SCOPe 2.07: d1yoxe2, d1yoxe3
  • Chain 'F':
    Compound: hypothetical protein PA3696
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA3696
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HXU4
      • modified residue (16)
      • modified residue (36)
      • modified residue (39)
      • modified residue (76)
    Domains in SCOPe 2.07: d1yoxf_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yoxA (A:)
    gsmasheldyrilgesmqtveieldpgetviaeagamnymtgdirftarmgdgsdgsllg
    klwsagkrklggesvfmthftnegqgkqhvafaapypgsvvavdlddvggrlfcqkdsfl
    caaygtrvgiaftkrlgagffggegfilqklegdglvfvhaggtlirrqlngetlrvdtg
    clvaftdgidydvqlagglksmlfggeglllttlkgsgtvwlqslpfsrlagriydatfr
    areevrtnng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yoxA (A:)
    eldyrilgesmqtveieldpgetviaeagamnymtgdirftarmthftnegqgkqhvafa
    apypgsvvavdlddvggrlfcqkdsflcaaygtrvgiaegfilqklegdglvfvhaggtl
    irrqlngetlrvdtgclvaftdgidydvqlaglllttlkgsgtvwlqslpfsrlagriyd
    atfrareevr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yoxB (B:)
    gsmasheldyrilgesmqtveieldpgetviaeagamnymtgdirftarmgdgsdgsllg
    klwsagkrklggesvfmthftnegqgkqhvafaapypgsvvavdlddvggrlfcqkdsfl
    caaygtrvgiaftkrlgagffggegfilqklegdglvfvhaggtlirrqlngetlrvdtg
    clvaftdgidydvqlagglksmlfggeglllttlkgsgtvwlqslpfsrlagriydatfr
    areevrtnng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yoxB (B:)
    asheldyrilgesmqtveieldpgetviaeagamnymtgdirftarmthftnegqgkqhv
    afaapypgsvvavdlddvggrlfcqkdsflcaaygtrvgiaftkrlgfilqklegdglvf
    vhaggtlirrqlngetlrvdtgclvaftdgidydvqlaggggeglllttlkgsgtvwlqs
    lpfsrlagriydatf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yoxC (C:)
    gsmasheldyrilgesmqtveieldpgetviaeagamnymtgdirftarmgdgsdgsllg
    klwsagkrklggesvfmthftnegqgkqhvafaapypgsvvavdlddvggrlfcqkdsfl
    caaygtrvgiaftkrlgagffggegfilqklegdglvfvhaggtlirrqlngetlrvdtg
    clvaftdgidydvqlagglksmlfggeglllttlkgsgtvwlqslpfsrlagriydatfr
    areevrtnng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yoxC (C:)
    eldyrilgesmqtveieldpgetviaeagamnymtgdirftarmthftnegqgkqhvafa
    apypgsvvavdlddvggrlfcqkdsflcaaygtrvgiaftkrlgagffggegfilqkleg
    dglvfvhaggtlirrqlngetlrvdtgclvaftdgidydvqlagglllttlkgsgtvwlq
    slpfsrlagriydatf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yoxD (D:)
    gsmasheldyrilgesmqtveieldpgetviaeagamnymtgdirftarmgdgsdgsllg
    klwsagkrklggesvfmthftnegqgkqhvafaapypgsvvavdlddvggrlfcqkdsfl
    caaygtrvgiaftkrlgagffggegfilqklegdglvfvhaggtlirrqlngetlrvdtg
    clvaftdgidydvqlagglksmlfggeglllttlkgsgtvwlqslpfsrlagriydatfr
    areevrtnng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yoxD (D:)
    asheldyrilgesmqtveieldpgetviaeagamnymtgdirftarmthftnegqgkqhv
    afaapypgsvvavdlddvggrlfcqkdsflcaaygtrvgiaftkrlgagffggegfilqk
    legdglvfvhaggtlirrqlngetlrvdtgclvaftdgidydvqlagglksmlfggegll
    lttlkgsgtvwlqslpfsrlagriydatf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yoxE (E:)
    gsmasheldyrilgesmqtveieldpgetviaeagamnymtgdirftarmgdgsdgsllg
    klwsagkrklggesvfmthftnegqgkqhvafaapypgsvvavdlddvggrlfcqkdsfl
    caaygtrvgiaftkrlgagffggegfilqklegdglvfvhaggtlirrqlngetlrvdtg
    clvaftdgidydvqlagglksmlfggeglllttlkgsgtvwlqslpfsrlagriydatfr
    areevrtnng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yoxE (E:)
    sheldyrilgesmqtveieldpgetviaeagamnymtgdirftarmgsvfmthftnegqg
    kqhvafaapypgsvvavdlddvggrlfcqkdsflcaaygtrvgiaftkrlgagffggegf
    ilqklegdglvfvhaggtlirrqlngetlrvdtgclvaftdgidydvqlaeglllttlkg
    sgtvwlqslpfsrlagriydatf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1yoxF (F:)
    gsmasheldyrilgesmqtveieldpgetviaeagamnymtgdirftarmgdgsdgsllg
    klwsagkrklggesvfmthftnegqgkqhvafaapypgsvvavdlddvggrlfcqkdsfl
    caaygtrvgiaftkrlgagffggegfilqklegdglvfvhaggtlirrqlngetlrvdtg
    clvaftdgidydvqlagglksmlfggeglllttlkgsgtvwlqslpfsrlagriydatfr
    areevrtnng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yoxF (F:)
    heldyrilgesmqtveieldpgetviaeagamnymtgdirftarmthftnegqgkqhvaf
    aapypgsvvavdlddvggrlfcqkdsflcaaygtrvgiafilqklegdglvfvhaggtli
    rrqlngetlrvdtgclvaftdgidydvqlalllttlkgsgtvwlqslpfsrlagriydat
    fraree