SCOPe 2.08: Domain d1yona1: 1yon A:168-292

Lineage for d1yona1 (1yon A:168-292)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.7: Ketopantoate reductase PanE [69084] (1 protein)
   automatically mapped to Pfam PF08546

6. Protein Ketopantoate reductase PanE [69085] (1 species)

7. Species Escherichia coli [TaxId:562] [69086] (4 PDB entries)

8. Domain d1yona1: 1yon A:168-292 [123780]
   Other proteins in same PDB: d1yona2
   automated match to d1ks9a1
   complexed with a2r

Details for d1yona1

PDB Entry: 1yon, 1.95 Å

PDB Description: Escherichia coli ketopantoate reductase in complex with 2-monophosphoadenosine-5'-diphosphate

PDB Compounds: (A:) 2-dehydropantoate 2-reductase

SCOPe Domain Sequences for d1yona1:

Sequence; same for both SEQRES and ATOM records:

>d1yona1 a.100.1.7 (A:168-292) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]}
niraelwrklavncvinpltaiwncpngelrhhpqeimqiceevaaviereghhtsaedl
rdyvmqvidataenissmlqdiralrhteidyingfllrrarahgiavpentrlfemvkr
kesey

Timeline for d1yona1:

• d1yona1 first appeared in SCOP 1.73
  
• d1yona1 appears in SCOPe 2.07