Lineage for d1ks9a1 (1ks9 A:168-291)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. Family a.100.1.7: Ketopantoate reductase PanE [69084] (1 protein)
    automatically mapped to Pfam PF08546
  6. Protein Ketopantoate reductase PanE [69085] (1 species)
  7. Species Escherichia coli [TaxId:562] [69086] (4 PDB entries)
  8. Domain d1ks9a1: 1ks9 A:168-291 [68857]
    Other proteins in same PDB: d1ks9a2

Details for d1ks9a1

PDB Entry: 1ks9 (more details), 1.7000000000000002 Å

PDB Description: Ketopantoate Reductase from Escherichia coli
PDB Compounds: (A:) 2-dehydropantoate 2-reductase

SCOPe Domain Sequences for d1ks9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ks9a1 a.100.1.7 (A:168-291) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]}
niraelwrklavncvinpltaiwncpngelrhhpqeimqiceevaaviereghhtsaedl
rdyvmqvidataenissmlqdiralrhteidyingfllrrarahgiavpentrlfemvkr
kese

SCOPe Domain Coordinates for d1ks9a1 are not available.

Timeline for d1ks9a1:

Domains from same chain:
(mouse over for more information)
d1ks9a2