PDB entry 1yon

View 1yon on RCSB PDB site
Description: Escherichia coli ketopantoate reductase in complex with 2-monophosphoadenosine-5'-diphosphate
Class: oxidoreductase
Keywords: ketopantoate, NADP+ DEPENDENT, 2'-monophosphoadenosine-5'-diphosphate, pantothenate pathway, secondary alcohol dehydrogenase, OXIDOREDUCTASE
Deposited on 2005-01-28, released 2006-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-19, with a file datestamp of 2014-11-14.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.168
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-dehydropantoate 2-reductase
    Species: Escherichia coli [TaxId:562]
    Gene: panE
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yona1, d1yona2
  • Heterogens: A2R, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yonA (A:)
    mkitvlgcgalgqlwltalckqghevqgwlrvpqpycsvnlvetdgsifnesltandpdf
    latsdlllvtlkawqvsdavkslastlpvttpillihngmgtieelqniqqpllmgttth
    aarrdgnviihvangithigparqqdgdysyladilqtvlpdvawhnniraelwrklavn
    cvinpltaiwncpngelrhhpqeimqiceevaaviereghhtsaedlrdyvmqvidatae
    nissmlqdiralrhteidyingfllrrarahgiavpentrlfemvkrkeseyerigtglp
    rpw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yonA (A:)
    mkitvlgcgalgqlwltalckqghevqgwlrvpqpycsvnlvetdgsifnesltandpdf
    latsdlllvtlkawqvsdavkslastlpvttpillihngmgtieelqniqqpllmgttth
    aarrdgnviihvangithigparqqdgdysyladilqtvlpdvawhnniraelwrklavn
    cvinpltaiwncpngelrhhpqeimqiceevaaviereghhtsaedlrdyvmqvidatae
    nissmlqdiralrhteidyingfllrrarahgiavpentrlfemvkrkesey