![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) ![]() |
![]() | Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
![]() | Protein Hypothetical protein PA1835 [143182] (1 species) |
![]() | Species Pseudomonas aeruginosa [TaxId:287] [143183] (1 PDB entry) Uniprot Q9I2R0 1-145 |
![]() | Domain d1yoca1: 1yoc A:1-145 [123778] Other proteins in same PDB: d1yocb3 complexed with gol |
PDB Entry: 1yoc (more details), 1.7 Å
SCOPe Domain Sequences for d1yoca1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yoca1 d.38.1.5 (A:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]} msqmmqmyqqvgpaqfsamigqfapyfasiapqfvelrpgyaevtfpkrrevlnhigtvh aialcnaaelaagtmtdasipaghrwiprgmtveylakatgdvravadgsqidwqatgnl vvpvvayvddkpvfraeitmyvsqa
Timeline for d1yoca1: