PDB entry 1yoc

View 1yoc on RCSB PDB site
Description: Crystal Structure of genomics APC5556
Class: structural genomics, unknown function
Keywords: PA1835, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, Sulfur SAD, UNKNOWN FUNCTION
Deposited on 2005-01-27, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.167
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein PA1835
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA1835
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yoca1
  • Chain 'B':
    Compound: hypothetical protein PA1835
    Species: PSEUDOMONAS AERUGINOSA [TaxId:208964]
    Gene: PA1835
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9I2R0 (2-146)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1yocb2, d1yocb3
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yocA (A:)
    afmsqmmqmyqqvgpaqfsamigqfapyfasiapqfvelrpgyaevtfpkrrevlnhigt
    vhaialcnaaelaagtmtdasipaghrwiprgmtveylakatgdvravadgsqidwqatg
    nlvvpvvayvddkpvfraeitmyvsqa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yocA (A:)
    msqmmqmyqqvgpaqfsamigqfapyfasiapqfvelrpgyaevtfpkrrevlnhigtvh
    aialcnaaelaagtmtdasipaghrwiprgmtveylakatgdvravadgsqidwqatgnl
    vvpvvayvddkpvfraeitmyvsqa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yocB (B:)
    afmsqmmqmyqqvgpaqfsamigqfapyfasiapqfvelrpgyaevtfpkrrevlnhigt
    vhaialcnaaelaagtmtdasipaghrwiprgmtveylakatgdvravadgsqidwqatg
    nlvvpvvayvddkpvfraeitmyvsqa