Lineage for d1yocb2 (1yoc B:1-145)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2943854Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. 2943876Protein Hypothetical protein PA1835 [143182] (1 species)
  7. 2943877Species Pseudomonas aeruginosa [TaxId:287] [143183] (1 PDB entry)
    Uniprot Q9I2R0 1-145
  8. 2943879Domain d1yocb2: 1yoc B:1-145 [123779]
    Other proteins in same PDB: d1yocb3
    automated match to d1yoca1
    complexed with gol

Details for d1yocb2

PDB Entry: 1yoc (more details), 1.7 Å

PDB Description: Crystal Structure of genomics APC5556
PDB Compounds: (B:) hypothetical protein PA1835

SCOPe Domain Sequences for d1yocb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yocb2 d.38.1.5 (B:1-145) Hypothetical protein PA1835 {Pseudomonas aeruginosa [TaxId: 287]}
msqmmqmyqqvgpaqfsamigqfapyfasiapqfvelrpgyaevtfpkrrevlnhigtvh
aialcnaaelaagtmtdasipaghrwiprgmtveylakatgdvravadgsqidwqatgnl
vvpvvayvddkpvfraeitmyvsqa

SCOPe Domain Coordinates for d1yocb2:

Click to download the PDB-style file with coordinates for d1yocb2.
(The format of our PDB-style files is described here.)

Timeline for d1yocb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yocb3
View in 3D
Domains from other chains:
(mouse over for more information)
d1yoca1