Lineage for d1ynnk1 (1ynn K:1-95)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1506616Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 1506617Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 1506618Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins)
    4 helices; irregular array
  6. 1506619Protein RNA polymerase omega subunit [63564] (3 species)
  7. 1506620Species Thermus aquaticus [TaxId:271] [63565] (3 PDB entries)
  8. 1506622Domain d1ynnk1: 1ynn K:1-95 [123746]
    Other proteins in same PDB: d1ynna1, d1ynna2, d1ynnb1, d1ynnb2, d1ynnc1, d1ynnd1
    automatically matched to d1i6ve_
    protein/RNA complex; complexed with rfp, zn

Details for d1ynnk1

PDB Entry: 1ynn (more details), 3.3 Å

PDB Description: Taq RNA polymerase-rifampicin complex
PDB Compounds: (K:) DNA-directed RNA polymerase omega chain

SCOPe Domain Sequences for d1ynnk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynnk1 a.143.1.1 (K:1-95) RNA polymerase omega subunit {Thermus aquaticus [TaxId: 271]}
maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
vtwamkelltgrlffgenlvpedrlqkemerlypt

SCOPe Domain Coordinates for d1ynnk1:

Click to download the PDB-style file with coordinates for d1ynnk1.
(The format of our PDB-style files is described here.)

Timeline for d1ynnk1: