| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily) core: 2 helices and adjacent loops |
Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) ![]() the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits |
| Family a.143.1.1: RNA polymerase omega subunit [63563] (2 proteins) 4 helices; irregular array |
| Protein RNA polymerase omega subunit [63564] (3 species) |
| Species Thermus aquaticus [TaxId:271] [63565] (3 PDB entries) |
| Domain d1ynnk1: 1ynn K:1-95 [123746] Other proteins in same PDB: d1ynna1, d1ynna2, d1ynnb1, d1ynnb2, d1ynnc1, d1ynnd1 automatically matched to d1i6ve_ protein/RNA complex; complexed with rfp, zn |
PDB Entry: 1ynn (more details), 3.3 Å
SCOPe Domain Sequences for d1ynnk1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ynnk1 a.143.1.1 (K:1-95) RNA polymerase omega subunit {Thermus aquaticus [TaxId: 271]}
maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
vtwamkelltgrlffgenlvpedrlqkemerlypt
Timeline for d1ynnk1: