Lineage for d1ynnk1 (1ynn K:1-95)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 649980Fold a.143: RPB6/omega subunit-like [63561] (1 superfamily)
    core: 2 helices and adjacent loops
  4. 649981Superfamily a.143.1: RPB6/omega subunit-like [63562] (2 families) (S)
    the bacterial omega and eukaryotic RPB6 subunits both function in polymerase assembly; the common core is involved in conserved interactions with other subunits
  5. 649982Family a.143.1.1: RNA polymerase omega subunit [63563] (1 protein)
    4 helices; irregular array
  6. 649983Protein RNA polymerase omega subunit [63564] (2 species)
  7. 649984Species Thermus aquaticus [TaxId:271] [63565] (3 PDB entries)
  8. 649986Domain d1ynnk1: 1ynn K:1-95 [123746]
    Other proteins in same PDB: d1ynna1, d1ynna2, d1ynnb1, d1ynnb2
    automatically matched to d1i6ve_
    complexed with rfp, zn

Details for d1ynnk1

PDB Entry: 1ynn (more details), 3.3 Å

PDB Description: Taq RNA polymerase-rifampicin complex
PDB Compounds: (K:) DNA-directed RNA polymerase omega chain

SCOP Domain Sequences for d1ynnk1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynnk1 a.143.1.1 (K:1-95) RNA polymerase omega subunit {Thermus aquaticus [TaxId: 271]}
maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
vtwamkelltgrlffgenlvpedrlqkemerlypt

SCOP Domain Coordinates for d1ynnk1:

Click to download the PDB-style file with coordinates for d1ynnk1.
(The format of our PDB-style files is described here.)

Timeline for d1ynnk1: