Lineage for d1ynnb2 (1ynn B:50-172)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1684390Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily)
    unusual fold; contains a left-handed beta-alpha-beta unit
  4. 1684391Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) (S)
    automatically mapped to Pfam PF01000
  5. 1684392Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (2 proteins)
  6. 1684393Protein RNA polymerase alpha subunit [56555] (3 species)
  7. 1684399Species Thermus aquaticus [TaxId:271] [64461] (4 PDB entries)
  8. 1684403Domain d1ynnb2: 1ynn B:50-172 [123745]
    Other proteins in same PDB: d1ynna1, d1ynnb1, d1ynnc1, d1ynnd1, d1ynnk1
    automatically matched to d1i6va2
    protein/RNA complex; complexed with rfp, zn

Details for d1ynnb2

PDB Entry: 1ynn (more details), 3.3 Å

PDB Description: Taq RNA polymerase-rifampicin complex
PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d1ynnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynnb2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus aquaticus [TaxId: 271]}
gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkev
ragdftpsadveimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvda
ifs

SCOPe Domain Coordinates for d1ynnb2:

Click to download the PDB-style file with coordinates for d1ynnb2.
(The format of our PDB-style files is described here.)

Timeline for d1ynnb2: