Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.181: Insert subdomain of RNA polymerase alpha subunit [56552] (1 superfamily) unusual fold; contains a left-handed beta-alpha-beta unit |
Superfamily d.181.1: Insert subdomain of RNA polymerase alpha subunit [56553] (1 family) automatically mapped to Pfam PF01000 |
Family d.181.1.1: Insert subdomain of RNA polymerase alpha subunit [56554] (3 proteins) |
Protein RNA polymerase alpha subunit [56555] (3 species) |
Species Thermus aquaticus [TaxId:271] [64461] (4 PDB entries) |
Domain d1ynnb2: 1ynn B:50-172 [123745] Other proteins in same PDB: d1ynna1, d1ynnb1, d1ynnc1, d1ynnd1, d1ynnk1 automatically matched to d1i6va2 protein/RNA complex; complexed with rfp, zn |
PDB Entry: 1ynn (more details), 3.3 Å
SCOPe Domain Sequences for d1ynnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ynnb2 d.181.1.1 (B:50-172) RNA polymerase alpha subunit {Thermus aquaticus [TaxId: 271]} gtavtsvyiedvlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkev ragdftpsadveimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvda ifs
Timeline for d1ynnb2: