Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.74: DCoH-like [55247] (5 superfamilies) beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta |
Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) form homo and heterodimers |
Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins) |
Protein RNA polymerase alpha [55259] (3 species) |
Species Thermus aquaticus [TaxId:271] [64314] (4 PDB entries) |
Domain d1ynnb1: 1ynn B:6-49,B:173-228 [123744] Other proteins in same PDB: d1ynna2, d1ynnb2, d1ynnc1, d1ynnd1, d1ynnk1 automatically matched to d1i6vb1 protein/RNA complex; complexed with rfp, zn |
PDB Entry: 1ynn (more details), 3.3 Å
SCOPe Domain Sequences for d1ynnb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ynnb1 d.74.3.1 (B:6-49,B:173-228) RNA polymerase alpha {Thermus aquaticus [TaxId: 271]} lkapvftattqgdhygefvleplergfgvtlgnplrrillssipXpvrrvafqvedtrlg qrtdldkltlriwtdgsvtplealnqavailkehlnyfanp
Timeline for d1ynnb1: