Lineage for d1ynnb1 (1ynn B:6-49,B:173-228)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958012Fold d.74: DCoH-like [55247] (5 superfamilies)
    beta(2)-alpha-beta(2)-alpha; 2 layers, alpha/beta
  4. 2958148Superfamily d.74.3: RBP11-like subunits of RNA polymerase [55257] (3 families) (S)
    form homo and heterodimers
  5. 2958149Family d.74.3.1: RNA polymerase alpha subunit dimerisation domain [55258] (3 proteins)
  6. 2958150Protein RNA polymerase alpha [55259] (3 species)
  7. 2958156Species Thermus aquaticus [TaxId:271] [64314] (4 PDB entries)
  8. 2958160Domain d1ynnb1: 1ynn B:6-49,B:173-228 [123744]
    Other proteins in same PDB: d1ynna2, d1ynnb2, d1ynnc1, d1ynnd1, d1ynnk1
    automatically matched to d1i6vb1
    protein/RNA complex; complexed with rfp, zn

Details for d1ynnb1

PDB Entry: 1ynn (more details), 3.3 Å

PDB Description: Taq RNA polymerase-rifampicin complex
PDB Compounds: (B:) DNA-directed RNA polymerase alpha chain

SCOPe Domain Sequences for d1ynnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynnb1 d.74.3.1 (B:6-49,B:173-228) RNA polymerase alpha {Thermus aquaticus [TaxId: 271]}
lkapvftattqgdhygefvleplergfgvtlgnplrrillssipXpvrrvafqvedtrlg
qrtdldkltlriwtdgsvtplealnqavailkehlnyfanp

SCOPe Domain Coordinates for d1ynnb1:

Click to download the PDB-style file with coordinates for d1ynnb1.
(The format of our PDB-style files is described here.)

Timeline for d1ynnb1: