PDB entry 1ynn

View 1ynn on RCSB PDB site
Description: Taq RNA polymerase-rifampicin complex
Class: transferase
Keywords: TRANSFERASE, RNA polymerase, RIFAMPICIN
Deposited on 2005-01-24, released 2005-03-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.274
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-directed RNA polymerase alpha chain
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ynna1, d1ynna2
  • Chain 'B':
    Compound: DNA-directed RNA polymerase alpha chain
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ynnb1, d1ynnb2
  • Chain 'C':
    Compound: DNA-directed RNA polymerase beta chain
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ynnc1
  • Chain 'D':
    Compound: DNA-directed RNA polymerase beta' chain
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ynnd1
  • Chain 'J':
    Compound: DNA-directed RNA polymerase beta' chain
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: DNA-directed RNA polymerase omega chain
    Species: Thermus aquaticus [TaxId:271]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ynnk1
  • Heterogens: ZN, RFP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ynnA (A:)
    mlesklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadv
    eimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasllptpevsk
    gekresaeedldlpleelglstrvlhslkeegiesvrallalnlkdlrnipgigerslee
    irqalakkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynnA (A:)
    lkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlhef
    stipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadveimnp
    dlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqvedtr
    lgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasllpt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ynnB (B:)
    mlesklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyied
    vlhefstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadv
    eimnpdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafq
    vedtrlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanpeasllptpevsk
    gekresaeedldlpleelglstrvlhslkeegiesvrallalnlkdlrnipgigerslee
    irqalakkgftlke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynnB (B:)
    sklkapvftattqgdhygefvleplergfgvtlgnplrrillssipgtavtsvyiedvlh
    efstipgvkedvveiilnlkelvvrfldpkmasttlilraegpkevragdftpsadveim
    npdlhiatleeggklymevrvdrgvgyvpaerhgikdrinaipvdaifspvrrvafqved
    trlgqrtdldkltlriwtdgsvtplealnqavailkehlnyfanp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ynnC (C:)
    meikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieegdkg
    kgglvldfleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlpl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasg
    vvtmkvnkrkfplvlllrvlgydqetlvrelsaygdlvqglldeavlamrpeeamvrlft
    llrpgdppkkdkalaylfglladpkrydlgeagrykaeeklgvglsgrtlvrfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmadqfrvglarlargvrermv
    mgspdtltpaklvnsrpleaalreffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdalgfirtpyrrvkngvvt
    eevvymtaseedrytiaqantplegdriatdrvvarrrgepvivapeevefmdvspkqvf
    slntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevvkvdgtriavryedgrlvehplrryarsnqgtafdqrprvrvgqrvkkgdlladgpa
    seegflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegivrigaevkpgdilvgrtsfkgeqepspeerllrsifge
    kardvkdtslrvppgeggivvgrlrlrrgdpgvelkpgvrevvrvfvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispvfdgatepeikellaeafnlyfgkrqgegfgvdkrekevlaraeklglvspgkspe
    eqlkelfdlgkvvlydgrtgepfegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltiksddiegrnaayqaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeglaskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynnC (C:)
    meikrfgrireviplpplteiqvesykkalqadvppekrenvgiqaafketfpieegdkg
    kgglvldfleyrigdppfsqdecrekdltyqaplyarlqlihkdtglikedevflghlpl
    mtedgsfiingadrvivsqihrspgvyftpdparpgryiasiiplpkrgpwidleveasg
    vvtmkvnkrkfplvlllrvlgydqetlvrelsaygdlvqglldeavlamrpeeamvrlft
    llrpgdppkkdkalaylfglladpkrydlgeagrykaeeklgvglsgrtlvrfedgefkd
    evflptlrylfaltagvpghevddidhlgnrrirtvgelmadqfrvglarlargvrermv
    mgspdtltpaklvnsrpleaalreffsrsqlsqfkdetnplsslrhkrrisalgpggltr
    eragfdvrdvhrthygricpvetpeganiglitslaayarvdalgfirtpyrrvkngvvt
    eevvymtaseedrytiaqantplegdriatdrvvarrrgepvivapeevefmdvspkqvf
    slntnlipflehddanralmgsnmqtqavpliraqapvvmtgleervvrdslaalyaeed
    gevvkvdgtriavryedgrlvehplrryarsnqgtafdqrprvrvgqrvkkgdlladgpa
    seegflalgqnvlvaimpfdgynfedaiviseellkrdfytsihieryeieardtklgpe
    ritrdiphlseaalrdldeegivrigaevkpgdilvgrtsfkgeqepspeerllrsifge
    kardvkdtslrvppgeggivvgrlrlrrgdpgvelkpgvrevvrvfvaqkrklqvgdkla
    nrhgnkgvvakilpvedmphlpdgtpvdvilnplgvpsrmnlgqilethlglagyflgqr
    yispvfdgatepeikellaeafnlyfgkrqgegfgvdkrekevlaraeklglvspgkspe
    eqlkelfdlgkvvlydgrtgepfegpivvgqmfimklyhmvedkmharstgpyslitqqp
    lggkaqfggqrfgemevwaleaygaahtlqemltiksddiegrnaayqaiikgedvpeps
    vpesfrvlvkelqalaldvqtldekdnpvdifeg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ynnD (D:)
    mkkevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecac
    gkykrqrfegkvcercgvevtrsivrryrmghielatpaahiwfvkdvpskigtlldlsa
    teleqvlyfnkyivldpkgavldgvpvekrqlltdeeyrelrygkqetyplpagvdalvk
    dgeevvkgqelapgvvsrmdgvalyrfprrvrvdylrkeraalriplsawvekeayrpge
    vlaelsepylfraeesgvvelkdlaeghliylrqeeevvaryflpagmtplvvegeivev
    gqplaegkgllrlprhmtakeveaeeegdsvhltlflewtepkdykvaphmnvivpegak
    vqagekivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevttgdrvapgdv
    ladggkvkseiygrvevdlvrnvvrvvesydidarmgaeaiqellkeldleklerellee
    mkhpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdl
    ndlyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtnpgserpl
    rsltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkk
    meekafapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvl
    vegqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplak
    psrdiilglyyitqvrkekkgagmafatpeealaayergevalnapivvagretsvgrlk
    fvfanpdeallavahglldlqdvvtvrylgrrletspgrilfarivgeavgdekvaqeli
    qmdvpqeknslkdlvyqaflrlgmektarlldalkyygftlsttsgitigiddavipeek
    qryleeadrklrqieqayemgfltdrerydqviqlwtettekvtqavfknfeenypfnpl
    yvmaqsgargnpqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfisshgarkg
    gadtalrtadsgyltrklvdvaheivvreadcgttnyisvplfqmdevtrtlrlrkrsdi
    esglygrvlarevealgrrleegrylsledvhflikaaeagevrevpvrspltcqtrygv
    cqkcygydlsmarpvsigeavgvvaaesigepgtqltmrtfhtggvavgtditqglprvi
    elfearrpkakaviseidgvvrieegedrlsvfvesegfskeyklpkdarllvkdgdyve
    agqpltrgaidphqlleakgpeaverylvdeiqkvyraqgvklhdkhieivvrqmlkyve
    vtdpgdsrllegqvlekwdvealnerliaegkvpvawkpllmgvtksalstkswlsaasf
    qntthvlteaaiagkkdeliglkenvilgrlipagtgsdfvrftqvvdqrtlkaieeark
    eaveakekeaprrpvrreqpgkgl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynnD (D:)
    kevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacgk
    ykrqrfegkvcercgvevtrsivrryrmghielatpaahiwfvkdvpskigtlldlsate
    leqvlyfnkyivldpkgavldgvpvekrqlltdeeyrelrygkqetyplpagvdalvkdg
    eevvkgqelapgvvsrmdgvalyrfprrvrvdylrkeraalriplsawvekeayrpgevl
    aelsepylfraeesgvvelkdlaeghliylrqeeevvaryflpagmtplvvegeivevgq
    plaegkgllrlprhmtakeveaeeegdsvhltlflewtepkdykvaphmnvivpegakvq
    agekivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevttgdrvapgdvla
    dggkvkseiygrvevdlvrnvvrvvesydidarmgaeaiqellkeldleklerelleemk
    hpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdlnd
    lyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtnpgserplrs
    ltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkme
    ekafapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlve
    gqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakps
    rdiilglyyitqvrkekkgagmafatpeealaayergevalnapivvagretsvgrlkfv
    fanpdeallavahglldlqdvvtvrylgrrletspgrilfarivgeavgdekvaqeliqm
    dvpqeknslkdlvyqaflrlgmektarlldalkyygftlsttsgitigiddavipeekqr
    yleeadrklrqieqayemgfltdrerydqviqlwtettekvtqavfknfeenypfnplyv
    maqsgargnpqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfisshgarkgga
    dtalrtadsgyltrklvdvaheivvreadcgttnyisvplfqmdevtrtlrlrkrsdies
    glygrvlarevealgrrleegrylsledvhflikaaeagevrevpvrspltcqtrygvcq
    kcygydlsmarpvsigeavgvvaaesigepgtqltmrt
    

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1ynnK (K:)
    maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
    vtwamkelltgrlffgenlvpedrlqkemerlypteeea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ynnK (K:)
    maepgidklfgmvdskyrltvvvakraqqllrhrfkntvlepeerpkmrtleglyddpna
    vtwamkelltgrlffgenlvpedrlqkemerlypt