Lineage for d1ynnd1 (1ynn D:3-1240)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574250Fold e.29: beta and beta-prime subunits of DNA dependent RNA-polymerase [64483] (1 superfamily)
    Multidomain subunits of complex domain organization
  4. 2574251Superfamily e.29.1: beta and beta-prime subunits of DNA dependent RNA-polymerase [64484] (2 families) (S)
    The catalytic site is formed by the association of two double-psi beta-barrel domains, one from each subunit
  5. 2574346Family e.29.1.2: RNA-polymerase beta-prime [64490] (4 proteins)
  6. 2574381Protein RNA-polymerase beta-prime [64493] (2 species)
  7. 2574382Species Thermus aquaticus [TaxId:271] [64494] (4 PDB entries)
  8. 2574384Domain d1ynnd1: 1ynn D:3-1240 [144706]
    Other proteins in same PDB: d1ynna1, d1ynna2, d1ynnb1, d1ynnb2, d1ynnc1, d1ynnk1
    automatically matched to 1YNJ D:3-1240
    protein/RNA complex; complexed with rfp, zn

Details for d1ynnd1

PDB Entry: 1ynn (more details), 3.3 Å

PDB Description: Taq RNA polymerase-rifampicin complex
PDB Compounds: (D:) DNA-directed RNA polymerase beta' chain

SCOPe Domain Sequences for d1ynnd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynnd1 e.29.1.2 (D:3-1240) RNA-polymerase beta-prime {Thermus aquaticus [TaxId: 271]}
kevrkvrialaspekirswsygevekpetinyrtlkperdglfderifgpikdyecacgk
ykrqrfegkvcercgvevtrsivrryrmghielatpaahiwfvkdvpskigtlldlsate
leqvlyfnkyivldpkgavldgvpvekrqlltdeeyrelrygkqetyplpagvdalvkdg
eevvkgqelapgvvsrmdgvalyrfprrvrvdylrkeraalriplsawvekeayrpgevl
aelsepylfraeesgvvelkdlaeghliylrqeeevvaryflpagmtplvvegeivevgq
plaegkgllrlprhmtakeveaeeegdsvhltlflewtepkdykvaphmnvivpegakvq
agekivaaidpeeeviaeaegvvhlhepasilvvkarvypfeddvevttgdrvapgdvla
dggkvkseiygrvevdlvrnvvrvvesydidarmgaeaiqellkeldleklerelleemk
hpsrarrakarkrlevvrafldsgnrpewmileavpvlppdlrpmvqvdggrfatsdlnd
lyrrlinrnnrlkkllaqgapeiiirnekrmlqeavdavidngrrgspvtnpgserplrs
ltdilsgkqgrfrqnllgkrvdysgrsvivvgpqlklhqcglpkrmalelfkpfllkkme
ekafapnvkaarrmlerqrdikdevwdaleevihgkvvllnraptlhrlgiqafqpvlve
gqsiqlhplvceafnadfdgdqmavhvplssfaqaeariqmlsahnllspasgeplakps
rdiilglyyitqvrkekkgagmafatpeealaayergevalnapivvagretsvgrlkfv
fanpdeallavahglldlqdvvtvrylgrrletspgrilfarivgeavgdekvaqeliqm
dvpqeknslkdlvyqaflrlgmektarlldalkyygftlsttsgitigiddavipeekqr
yleeadrklrqieqayemgfltdrerydqviqlwtettekvtqavfknfeenypfnplyv
maqsgargnpqqirqlcgmrglmqkpsgetfevpvrssfregltvleyfisshgarkgga
dtalrtadsgyltrklvdvaheivvreadcgttnyisvplfqmdevtrtlrlrkrsdies
glygrvlarevealgrrleegrylsledvhflikaaeagevrevpvrspltcqtrygvcq
kcygydlsmarpvsigeavgvvaaesigepgtqltmrt

SCOPe Domain Coordinates for d1ynnd1:

Click to download the PDB-style file with coordinates for d1ynnd1.
(The format of our PDB-style files is described here.)

Timeline for d1ynnd1: