![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.1: RmlC-like cupins [51182] (25 families) ![]() |
![]() | Family b.82.1.17: PA5104-like [141609] (2 proteins) Pfam PF05962; DUF886; duplication: consists of two germin-like domains; overall structural similarity to the YlbA-like family (101979) except a deletion in the interdomain linker region |
![]() | Protein automated matches [190833] (1 species) not a true protein |
![]() | Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [188139] (1 PDB entry) |
![]() | Domain d1yllc_: 1yll C: [123655] Other proteins in same PDB: d1ylla1, d1yllb3, d1ylld3 automated match to d1ylla1 |
PDB Entry: 1yll (more details), 1.64 Å
SCOPe Domain Sequences for d1yllc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yllc_ b.82.1.17 (C:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]} selrilravdyprmpwkngagsteeiardggdgldgfgwrlsiadvgesggfsgfagyqr iisvlegggmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrhrar lqwlrvegeldwhgtastlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhwrlt ahepawvcavelds
Timeline for d1yllc_: