SCOPe 2.08: Domain d1ylla1: 1yll A:2-196

Lineage for d1ylla1 (1yll A:2-196)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.17: PA5104-like [141609] (2 proteins)
   Pfam PF05962; DUF886; duplication: consists of two germin-like domains; overall structural similarity to the YlbA-like family (101979) except a deletion in the interdomain linker region

6. Protein Hypothetical protein PA5104 [141610] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [141611] (1 PDB entry)
   Uniprot Q9HU79 2-196

8. Domain d1ylla1: 1yll A:2-196 [123653]
   Other proteins in same PDB: d1yllb2, d1yllb3, d1yllc_, d1ylld2, d1ylld3

Details for d1ylla1

PDB Entry: 1yll, 1.64 Å

PDB Description: Crystal Structure of the Conserved Protein of Unknown Function PA5104 from Pseudomonas aeruginosa PAO1

PDB Compounds: (A:) conserved hypothetical protein

SCOPe Domain Sequences for d1ylla1:

Sequence, based on SEQRES records:

>d1ylla1 b.82.1.17 (A:2-196) Hypothetical protein PA5104 {Pseudomonas aeruginosa [TaxId: 287]}
selrilravdyprmpwkngagsteeiardggdgldgfgwrlsiadvgesggfsgfagyqr
iisvlegggmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrhrar
lqwlrvegeldwhgtastlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhwrlt
ahepawvcaveldsl

Sequence, based on observed residues (ATOM records):

>d1ylla1 b.82.1.17 (A:2-196) Hypothetical protein PA5104 {Pseudomonas aeruginosa [TaxId: 287]}
selrilravdyprmpgsteeiardggdgldgfgwrlsiadvgesggfsgfagyqriisvl
egggmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrhrarlqwlr
vegeldwhgtastlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhwrltahepa
wvcaveldsl

Timeline for d1ylla1:

• d1ylla1 first appeared in SCOP 1.73
  
• d1ylla1 appears in SCOPe 2.07