SCOPe 2.08: Domain d1yllb2: 1yll B:3-196

Lineage for d1yllb2 (1yll B:3-196)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.1: RmlC-like cupins [51182] (25 families)

5. Family b.82.1.17: PA5104-like [141609] (2 proteins)
   Pfam PF05962; DUF886; duplication: consists of two germin-like domains; overall structural similarity to the YlbA-like family (101979) except a deletion in the interdomain linker region

6. Protein automated matches [190833] (1 species)
   not a true protein

7. Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [188139] (1 PDB entry)

8. Domain d1yllb2: 1yll B:3-196 [123654]
   Other proteins in same PDB: d1ylla1, d1yllb3, d1ylld3
   automated match to d1ylla1

Details for d1yllb2

PDB Entry: 1yll, 1.64 Å

PDB Description: Crystal Structure of the Conserved Protein of Unknown Function PA5104 from Pseudomonas aeruginosa PAO1

PDB Compounds: (B:) conserved hypothetical protein

SCOPe Domain Sequences for d1yllb2:

Sequence, based on SEQRES records:

>d1yllb2 b.82.1.17 (B:3-196) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
elrilravdyprmpwkngagsteeiardggdgldgfgwrlsiadvgesggfsgfagyqri
isvlegggmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrhrarl
qwlrvegeldwhgtastlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhwrlta
hepawvcaveldsl

Sequence, based on observed residues (ATOM records):

>d1yllb2 b.82.1.17 (B:3-196) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
elrilravdyprmpwkngagsteeiardgfgwrlsiadvgesggfsgfagyqriisvleg
ggmrlrvdgaesaplrarqafafsgdsevhctlldgairdfnliyaprrhrarlqwlrve
geldwhgtastlllfaqqdgvaislqgqprgqlaahdclcaeglqglqhwrltahepawv
caveldsl

Timeline for d1yllb2:

• d1yllb2 first appeared in SCOP 1.73, called d1yllb1
  
• d1yllb2 appears in SCOPe 2.07