Lineage for d1yksa1 (1yks A:187-324)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2870435Family c.37.1.14: RNA helicase [52724] (7 proteins)
    duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension
  6. 2870516Protein YFV helicase, N-terminal domain [418964] (1 species)
  7. 2870517Species Yellow fever virus [TaxId:11089] [419426] (2 PDB entries)
    Uniprot P19901
  8. 2870518Domain d1yksa1: 1yks A:187-324 [123561]
    Other proteins in same PDB: d1yksa2, d1yksa3

Details for d1yksa1

PDB Entry: 1yks (more details), 1.8 Å

PDB Description: Crystal structure of yellow fever virus NS3 helicase
PDB Compounds: (A:) Genome polyprotein [contains: Flavivirin protease NS3 catalytic subunit]

SCOPe Domain Sequences for d1yksa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yksa1 c.37.1.14 (A:187-324) YFV helicase, N-terminal domain {Yellow fever virus [TaxId: 11089]}
mlkkgmttvldfhpgagktrrflpqilaecarrrlrtlvlaptrvvlsemkeafhgldvk
fhtqafsahgsgrevidamchatltyrmleptrvvnweviimdeahfldpasiaargwaa
hraranesatilmtatpp

SCOPe Domain Coordinates for d1yksa1:

Click to download the PDB-style file with coordinates for d1yksa1.
(The format of our PDB-style files is described here.)

Timeline for d1yksa1: