![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.14: RNA helicase [52724] (7 proteins) duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension |
![]() | Protein YFV helicase, N-terminal domain [418964] (1 species) |
![]() | Species Yellow fever virus [TaxId:11089] [419426] (2 PDB entries) Uniprot P19901 |
![]() | Domain d1yksa1: 1yks A:187-324 [123561] Other proteins in same PDB: d1yksa2, d1yksa3 |
PDB Entry: 1yks (more details), 1.8 Å
SCOPe Domain Sequences for d1yksa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yksa1 c.37.1.14 (A:187-324) YFV helicase, N-terminal domain {Yellow fever virus [TaxId: 11089]} mlkkgmttvldfhpgagktrrflpqilaecarrrlrtlvlaptrvvlsemkeafhgldvk fhtqafsahgsgrevidamchatltyrmleptrvvnweviimdeahfldpasiaargwaa hraranesatilmtatpp
Timeline for d1yksa1: