SCOP 1.73: Domain d1yksa1: 1yks A:185-324

Lineage for d1yksa1 (1yks A:185-324)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (24 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.14: RNA helicase [52724] (3 proteins)
   duplication: consists of two similar domains, one binds NTP and the other binds RNA; also contains an all-alpha subdomain in the C-terminal extension

6. Protein YFV helicase domain [142330] (1 species)

7. Species Yellow fever virus [TaxId:11089] [142331] (1 PDB entry)

8. Domain d1yksa1: 1yks A:185-324 [123561]

Details for d1yksa1

PDB Entry: 1yks, 1.8 Å

PDB Description: Crystal structure of yellow fever virus NS3 helicase

PDB Compounds: (A:) Genome polyprotein [contains: Flavivirin protease NS3 catalytic subunit]

SCOP Domain Sequences for d1yksa1:

Sequence; same for both SEQRES and ATOM records:

>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]}
shmlkkgmttvldfhpgagktrrflpqilaecarrrlrtlvlaptrvvlsemkeafhgld
vkfhtqafsahgsgrevidamchatltyrmleptrvvnweviimdeahfldpasiaargw
aahraranesatilmtatpp

Timeline for d1yksa1:

• d1yksa1 is new in SCOP 1.73
  
• d1yksa1 appears in SCOP 1.75
  
• d1yksa1 appears in the current release, SCOPe 2.08