Lineage for d1yj1c1 (1yj1 C:1-59)

  1. Root: SCOPe 2.06
  2. 2273425Class k: Designed proteins [58788] (44 folds)
  3. 2274045Fold k.45: Ubiquitin [144344] (1 superfamily)
  4. 2274046Superfamily k.45.1: Ubiquitin [144345] (1 family) (S)
  5. 2274047Family k.45.1.1: Ubiquitin [144346] (1 protein)
  6. 2274048Protein Ubiquitin [144347] (1 species)
  7. 2274049Species Synthetic [144348] (6 PDB entries)
  8. 2274052Domain d1yj1c1: 1yj1 C:1-59 [123379]
    Other proteins in same PDB: d1yj1a2, d1yj1b2, d1yj1c2
    automatically matched to 1YJ1 A:1-71
    complexed with cd, cl

Details for d1yj1c1

PDB Entry: 1yj1 (more details), 1.3 Å

PDB Description: x-ray crystal structure of a chemically synthesized [d-gln35]ubiquitin
PDB Compounds: (C:) Ubiquitin

SCOPe Domain Sequences for d1yj1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yj1c1 k.45.1.1 (C:1-59) Ubiquitin {Synthetic}
lqifvktltgktitlevepsdtienvkakiqdkeqippdqqrlifagkqledgrtlsdy

SCOPe Domain Coordinates for d1yj1c1:

Click to download the PDB-style file with coordinates for d1yj1c1.
(The format of our PDB-style files is described here.)

Timeline for d1yj1c1: