Lineage for d1yj1c1 (1yj1 C:1-71)

  1. Root: SCOP 1.73
  2. 757717Class k: Designed proteins [58788] (44 folds)
  3. 758306Fold k.45: Ubiquitin [144344] (1 superfamily)
  4. 758307Superfamily k.45.1: Ubiquitin [144345] (1 family) (S)
  5. 758308Family k.45.1.1: Ubiquitin [144346] (1 protein)
  6. 758309Protein Ubiquitin [144347] (1 species)
  7. 758310Species synthetic [144348] (6 PDB entries)
  8. 758313Domain d1yj1c1: 1yj1 C:1-71 [123379]
    automatically matched to 1YJ1 A:1-71

Details for d1yj1c1

PDB Entry: 1yj1 (more details), 1.3 Å

PDB Description: x-ray crystal structure of a chemically synthesized [d-gln35]ubiquitin
PDB Compounds: (C:) Ubiquitin

SCOP Domain Sequences for d1yj1c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yj1c1 k.45.1.1 (C:1-71) Ubiquitin {synthetic}
lqifvktltgktitlevepsdtienvkakiqdkeqippdqqrlifagkqledgrtlsdyn
iqkestlhlvl

SCOP Domain Coordinates for d1yj1c1:

Click to download the PDB-style file with coordinates for d1yj1c1.
(The format of our PDB-style files is described here.)

Timeline for d1yj1c1: