| Class k: Designed proteins [58788] (44 folds) |
| Fold k.45: Ubiquitin [144344] (1 superfamily) |
Superfamily k.45.1: Ubiquitin [144345] (1 family) ![]() |
| Family k.45.1.1: Ubiquitin [144346] (1 protein) |
| Protein Ubiquitin [144347] (1 species) |
| Species Synthetic [144348] (6 PDB entries) |
| Domain d1yj1c1: 1yj1 C:1-59 [123379] Other proteins in same PDB: d1yj1a2, d1yj1b2, d1yj1c2 automatically matched to 1YJ1 A:1-71 complexed with cd, cl |
PDB Entry: 1yj1 (more details), 1.3 Å
SCOPe Domain Sequences for d1yj1c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yj1c1 k.45.1.1 (C:1-59) Ubiquitin {Synthetic}
lqifvktltgktitlevepsdtienvkakiqdkeqippdqqrlifagkqledgrtlsdy
Timeline for d1yj1c1:
View in 3DDomains from other chains: (mouse over for more information) d1yj1a1, d1yj1a2, d1yj1b1, d1yj1b2 |