Lineage for d1yf3a1 (1yf3 A:1-259)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the restSuperfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) 
Family c.66.1.28: N6 adenine-specific DNA methylase, DAM [88788] (3 proteins)
automatically mapped to Pfam PF02086Protein DNA methylase T4DAM [102584] (2 species) 
Species Bacteriophage T4 [TaxId:10665] [102585] (5 PDB entries) 
Domain d1yf3a1: 1yf3 A:1-259 [123046]
protein/DNA complex; complexed with gol, sah
Details for d1yf3a1
PDB Entry: 1yf3 (more details), 2.29 Å
PDB Description: t4dam in complex with adohcy and 13-mer oligonucleotide making non- and semi-specific (~1/4) contact
PDB Compounds: (A:) DNA adenine methylaseSCOPe Domain Sequences for d1yf3a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yf3a1 c.66.1.28 (A:1-259) DNA methylase T4DAM {Bacteriophage T4 [TaxId: 10665]}
mlgaiaytgnkqsllpelkshfpkynrfvdlfcgglsvslnvngpvlandiqepiiemyk
rlinvswddvlkvikqyklsktskeeflklredynktrdplllyvlhfhgfsnmirinyk
gnfttpfgkrtinknsekrfnhfkqncdkiifsslhfkdvkildgdfvyvdppylitvad
ynkfwsedeekdllnlldslndrgikfglsnvlehhgkentllkewskkynvkhlnkkyv
fniyhskekngtdevyifn
SCOPe Domain Coordinates for d1yf3a1:
Click to download the PDB-style file with coordinates for d1yf3a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yf3a1:
- d1yf3a1 first appeared in SCOP 1.73
- d1yf3a1 appears in SCOPe 2.07
View in 3D
