Lineage for d1yf3a1 (1yf3 A:1-259)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2500487Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2500488Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2501514Family c.66.1.28: N6 adenine-specific DNA methylase, DAM [88788] (3 proteins)
    automatically mapped to Pfam PF02086
  6. 2501518Protein DNA methylase T4DAM [102584] (2 species)
  7. 2501519Species Bacteriophage T4 [TaxId:10665] [102585] (5 PDB entries)
  8. 2501521Domain d1yf3a1: 1yf3 A:1-259 [123046]
    protein/DNA complex; complexed with gol, sah

Details for d1yf3a1

PDB Entry: 1yf3 (more details), 2.29 Å

PDB Description: t4dam in complex with adohcy and 13-mer oligonucleotide making non- and semi-specific (~1/4) contact
PDB Compounds: (A:) DNA adenine methylase

SCOPe Domain Sequences for d1yf3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yf3a1 c.66.1.28 (A:1-259) DNA methylase T4DAM {Bacteriophage T4 [TaxId: 10665]}
mlgaiaytgnkqsllpelkshfpkynrfvdlfcgglsvslnvngpvlandiqepiiemyk
rlinvswddvlkvikqyklsktskeeflklredynktrdplllyvlhfhgfsnmirinyk
gnfttpfgkrtinknsekrfnhfkqncdkiifsslhfkdvkildgdfvyvdppylitvad
ynkfwsedeekdllnlldslndrgikfglsnvlehhgkentllkewskkynvkhlnkkyv
fniyhskekngtdevyifn

SCOPe Domain Coordinates for d1yf3a1:

Click to download the PDB-style file with coordinates for d1yf3a1.
(The format of our PDB-style files is described here.)

Timeline for d1yf3a1: