SCOPe 2.07: Domain d1yd9a1: 1yd9 A:6-193

Lineage for d1yd9a1 (1yd9 A:6-193)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.2: Macro domain [89724] (7 proteins)
   found in different proteins, including macro-H2a histone and the Appr-1"-p processing enzyme

6. Protein Histone macro-H2a1.1 [142547] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [142548] (1 PDB entry)
   Uniprot Q02874 180-370

8. Domain d1yd9a1: 1yd9 A:6-193 [122976]
   Other proteins in same PDB: d1yd9b_, d1yd9c2, d1yd9c3, d1yd9d_
   Isoform 1
   complexed with au

Details for d1yd9a1

PDB Entry: 1yd9, 1.6 Å

PDB Description: 1.6A Crystal Structure of the Non-Histone Domain of the Histone Variant MacroH2A1.1.

PDB Compounds: (A:) Core histone macro-H2A.1

SCOPe Domain Sequences for d1yd9a1:

Sequence; same for both SEQRES and ATOM records:

>d1yd9a1 c.50.1.2 (A:6-193) Histone macro-H2a1.1 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gftvlstkslflgqklqvvqadiasidsdavvhptntdfyiggevgstlekkggkefvea
vlelrkkngplevagaavsaghglpakfvihcnspvwgsdkceellektvknclaladdr
klksiafpsigsgrngfpkqtaaqlilkaissyfvstmsssiktvyfvlfdsesigiyvq
emakldan

Timeline for d1yd9a1:

• d1yd9a1 first appeared in SCOP 1.73
  
• d1yd9a1 appears in SCOPe 2.06
  
• d1yd9a1 appears in the current release, SCOPe 2.08