![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
![]() | Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) ![]() |
![]() | Family d.157.1.3: ROO N-terminal domain-like [56291] (4 proteins) |
![]() | Protein automated matches [227097] (3 species) not a true protein |
![]() | Domain d1ycfd2: 1ycf D:2-250 [122948] Other proteins in same PDB: d1ycfa1, d1ycfa2, d1ycfb1, d1ycfc1, d1ycfd1 automated match to d1ycga2 complexed with feo, fmn, oxy, zn |
PDB Entry: 1ycf (more details), 3 Å
SCOPe Domain Sequences for d1ycfd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ycfd2 d.157.1.3 (D:2-250) automated matches {Moorella thermoacetica [TaxId: 1525]} sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie ayarwaegq
Timeline for d1ycfd2: