SCOPe 2.08: Domain d1ycfd1: 1ycf D:251-399

Lineage for d1ycfd1 (1ycf D:251-399)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.5: Flavoproteins [52218] (9 families)

5. Family c.23.5.0: automated matches [191330] (1 protein)
   not a true family

6. Protein automated matches [190158] (31 species)
   not a true protein

7. Species Moorella thermoacetica [TaxId:1525] [254979] (1 PDB entry)

8. Domain d1ycfd1: 1ycf D:251-399 [122947]
   Other proteins in same PDB: d1ycfa1, d1ycfa2, d1ycfb2, d1ycfc2, d1ycfd2
   automated match to d1ycga1
   complexed with feo, fmn, oxy, zn

Details for d1ycfd1

PDB Entry: 1ycf, 3 Å

PDB Description: oxidized (di-ferric) fpra from moorella thermoacetica

PDB Compounds: (D:) Nitric oxide reductase

SCOPe Domain Sequences for d1ycfd1:

Sequence; same for both SEQRES and ATOM records:

>d1ycfd1 c.23.5.0 (D:251-399) automated matches {Moorella thermoacetica [TaxId: 1525]}
gkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikeildaravlvg
sptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlkaakieliaep
gptvqwvprgedlqrcyelgrkiaariad

Timeline for d1ycfd1:

• d1ycfd1 first appeared in SCOP 1.73
  
• d1ycfd1 appears in SCOPe 2.07