PDB entry 1ycf

View 1ycf on RCSB PDB site
Description: Oxidized (di-ferric) FprA from Moorella thermoacetica
Class: oxidoreductase
Keywords: Scavenging Nitric Oxide reductase, diron site structure, diferrous-dinitrosyl, OXIDOREDUCTASE
Deposited on 2004-12-22, released 2005-04-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-09-21, with a file datestamp of 2016-09-16.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nitric oxide reductase
    Species: Moorella thermoacetica [TaxId:1525]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ycfa1, d1ycfa2
  • Chain 'B':
    Compound: Nitric oxide reductase
    Species: Moorella thermoacetica [TaxId:1525]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ycfb1, d1ycfb2
  • Chain 'C':
    Compound: Nitric oxide reductase
    Species: Moorella thermoacetica [TaxId:1525]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ycfc1, d1ycfc2
  • Chain 'D':
    Compound: Nitric oxide reductase
    Species: Moorella thermoacetica [TaxId:1525]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ycfd1, d1ycfd2
  • Heterogens: ZN, FEO, OXY, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ycfA (A:)
    sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
    iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
    nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
    qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
    ayarwaegqgkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikei
    ldaravlvgsptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlka
    akieliaepgptvqwvprgedlqrcyelgrkiaariad
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ycfB (B:)
    sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
    iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
    nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
    qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
    ayarwaegqgkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikei
    ldaravlvgsptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlka
    akieliaepgptvqwvprgedlqrcyelgrkiaariad
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ycfC (C:)
    sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
    iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
    nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
    qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
    ayarwaegqgkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikei
    ldaravlvgsptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlka
    akieliaepgptvqwvprgedlqrcyelgrkiaariad
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ycfD (D:)
    sqpvaitdgiywvgavdwniryfhgpafsthrgttynaylivddktalvdtvyepfkeel
    iaklkqikdpvkldylvvnhtesdhagafpaimelcpdahvlctqrafdslkahyshidf
    nytivktgtsvslgkrsltfieapmlhwpdsmftyvpeealllpndafgqhiatsvrfdd
    qvdaglimdeaakyyanilmpfsnlitkkldeiqkinlaiktiapshgiiwrkdpgriie
    ayarwaegqgkakaviaydtmwlstekmahalmdglvaggcevklfklsvsdrndvikei
    ldaravlvgsptinndilpvvspllddlvglrpknkvglafgaygwgggaqkileerlka
    akieliaepgptvqwvprgedlqrcyelgrkiaariad