Lineage for d1yc2e_ (1yc2 E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2862578Fold c.31: DHS-like NAD/FAD-binding domain [52466] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456; Rossmann-like
  4. 2862579Superfamily c.31.1: DHS-like NAD/FAD-binding domain [52467] (7 families) (S)
    binds cofactor molecules in the opposite direction than classical Rossmann fold
  5. 2862892Family c.31.1.5: Sir2 family of transcriptional regulators [63984] (8 proteins)
    silent information regulator 2; contains insertion of a rubredoxin-like zinc finger domain
  6. 2862893Protein AF0112, Sir2 homolog (Sir2-AF2) [82380] (1 species)
  7. 2862894Species Archaeoglobus fulgidus [TaxId:2234] [82381] (3 PDB entries)
  8. 2862905Domain d1yc2e_: 1yc2 E: [122907]
    automated match to d1ma3a_
    complexed with 2pe, apr, edo, nad, nca, pg4, pge, so4, zn

Details for d1yc2e_

PDB Entry: 1yc2 (more details), 2.4 Å

PDB Description: Sir2Af2-NAD-ADPribose-nicotinamide
PDB Compounds: (E:) NAD-dependent deacetylase 2

SCOPe Domain Sequences for d1yc2e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yc2e_ c.31.1.5 (E:) AF0112, Sir2 homolog (Sir2-AF2) {Archaeoglobus fulgidus [TaxId: 2234]}
medeirkaaeilakskhavvftgagisaesgiptfrgedglwrkydpeevasisgfkrnp
rafwefsmemkdklfaepnpahyaiaelermgivkavitqnidmlhqragsrrvlelhgs
mdkldcldchetydwsefvedfnkgeiprcrkcgsyyvkprvvlfgeplpqrtlfeaiee
akhcdafmvvgsslvvypaaelpyiakkagakmiivnaeptmadpifdvkiigkagevlp
kiveevkrlr

SCOPe Domain Coordinates for d1yc2e_:

Click to download the PDB-style file with coordinates for d1yc2e_.
(The format of our PDB-style files is described here.)

Timeline for d1yc2e_: