PDB entry 1yc2

View 1yc2 on RCSB PDB site
Description: Sir2Af2-NAD-ADPribose-nicotinamide
Class: hydrolase
Keywords: sir2, sirtuin, nicotinamide, NAD, ADPribose, ternary complex, HYDROLASE
Deposited on 2004-12-21, released 2005-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.209
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NAD-dependent deacetylase 2
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: npdA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yc2a_
  • Chain 'B':
    Compound: NAD-dependent deacetylase 2
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: npdA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yc2b_
  • Chain 'C':
    Compound: NAD-dependent deacetylase 2
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: npdA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yc2c_
  • Chain 'D':
    Compound: NAD-dependent deacetylase 2
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: npdA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yc2d_
  • Chain 'E':
    Compound: NAD-dependent deacetylase 2
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Gene: npdA2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yc2e_
  • Heterogens: ZN, SO4, NAD, APR, NCA, 2PE, PG4, EDO, PGE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yc2A (A:)
    medeirkaaeilakskhavvftgagisaesgiptfrgedglwrkydpeevasisgfkrnp
    rafwefsmemkdklfaepnpahyaiaelermgivkavitqnidmlhqragsrrvlelhgs
    mdkldcldchetydwsefvedfnkgeiprcrkcgsyyvkprvvlfgeplpqrtlfeaiee
    akhcdafmvvgsslvvypaaelpyiakkagakmiivnaeptmadpifdvkiigkagevlp
    kiveevkrlrsek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yc2A (A:)
    medeirkaaeilakskhavvftgagisaesgiptfrgedglwrkydpeevasisgfkrnp
    rafwefsmemkdklfaepnpahyaiaelermgivkavitqnidmlhqragsrrvlelhgs
    mdkldcldchetydwsefvedfnkgeiprcrkcgsyyvkprvvlfgeplpqrtlfeaiee
    akhcdafmvvgsslvvypaaelpyiakkagakmiivnaeptmadpifdvkiigkagevlp
    kiveevkrlrse
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yc2B (B:)
    medeirkaaeilakskhavvftgagisaesgiptfrgedglwrkydpeevasisgfkrnp
    rafwefsmemkdklfaepnpahyaiaelermgivkavitqnidmlhqragsrrvlelhgs
    mdkldcldchetydwsefvedfnkgeiprcrkcgsyyvkprvvlfgeplpqrtlfeaiee
    akhcdafmvvgsslvvypaaelpyiakkagakmiivnaeptmadpifdvkiigkagevlp
    kiveevkrlrsek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yc2B (B:)
    medeirkaaeilakskhavvftgagisaesgiptfrgedglwrkydpeevasisgfkrnp
    rafwefsmemkdklfaepnpahyaiaelermgivkavitqnidmlhqragsrrvlelhgs
    mdkldcldchetydwsefvedfnkgeiprcrkcgsyyvkprvvlfgeplpqrtlfeaiee
    akhcdafmvvgsslvvypaaelpyiakkagakmiivnaeptmadpifdvkiigkagevlp
    kiveevkrlrse
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yc2C (C:)
    medeirkaaeilakskhavvftgagisaesgiptfrgedglwrkydpeevasisgfkrnp
    rafwefsmemkdklfaepnpahyaiaelermgivkavitqnidmlhqragsrrvlelhgs
    mdkldcldchetydwsefvedfnkgeiprcrkcgsyyvkprvvlfgeplpqrtlfeaiee
    akhcdafmvvgsslvvypaaelpyiakkagakmiivnaeptmadpifdvkiigkagevlp
    kiveevkrlrsek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yc2C (C:)
    medeirkaaeilakskhavvftgagisaesgiptfrgedglwrkydpeevasisgfkrnp
    rafwefsmemkdklfaepnpahyaiaelermgivkavitqnidmlhqragsrrvlelhgs
    mdkldcldchetydwsefvedfnkgeiprcrkcgsyyvkprvvlfgeplpqrtlfeaiee
    akhcdafmvvgsslvvypaaelpyiakkagakmiivnaeptmadpifdvkiigkagevlp
    kiveevkrlrse
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yc2D (D:)
    medeirkaaeilakskhavvftgagisaesgiptfrgedglwrkydpeevasisgfkrnp
    rafwefsmemkdklfaepnpahyaiaelermgivkavitqnidmlhqragsrrvlelhgs
    mdkldcldchetydwsefvedfnkgeiprcrkcgsyyvkprvvlfgeplpqrtlfeaiee
    akhcdafmvvgsslvvypaaelpyiakkagakmiivnaeptmadpifdvkiigkagevlp
    kiveevkrlrsek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yc2D (D:)
    edeirkaaeilakskhavvftgagisaesgiptfrgedglwrkydpeevasisgfkrnpr
    afwefsmemkdklfaepnpahyaiaelermgivkavitqnidmlhqragsrrvlelhgsm
    dkldcldchetydwsefvedfnkgeiprcrkcgsyyvkprvvlfgeplpqrtlfeaieea
    khcdafmvvgsslvvypaaelpyiakkagakmiivnaeptmadpifdvkiigkagevlpk
    iveevkrlrse
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1yc2E (E:)
    medeirkaaeilakskhavvftgagisaesgiptfrgedglwrkydpeevasisgfkrnp
    rafwefsmemkdklfaepnpahyaiaelermgivkavitqnidmlhqragsrrvlelhgs
    mdkldcldchetydwsefvedfnkgeiprcrkcgsyyvkprvvlfgeplpqrtlfeaiee
    akhcdafmvvgsslvvypaaelpyiakkagakmiivnaeptmadpifdvkiigkagevlp
    kiveevkrlrsek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yc2E (E:)
    medeirkaaeilakskhavvftgagisaesgiptfrgedglwrkydpeevasisgfkrnp
    rafwefsmemkdklfaepnpahyaiaelermgivkavitqnidmlhqragsrrvlelhgs
    mdkldcldchetydwsefvedfnkgeiprcrkcgsyyvkprvvlfgeplpqrtlfeaiee
    akhcdafmvvgsslvvypaaelpyiakkagakmiivnaeptmadpifdvkiigkagevlp
    kiveevkrlr