Lineage for d1yaua_ (1yau A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2988529Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 2993312Protein automated matches [190144] (14 species)
    not a true protein
  7. 2995759Species Thermoplasma acidophilum [TaxId:2303] [186869] (4 PDB entries)
  8. 2995788Domain d1yaua_: 1yau A: [122851]
    Other proteins in same PDB: d1yauo_, d1yaup_, d1yauq_, d1yaur_, d1yaus_, d1yaut_, d1yauu_
    automated match to d1pmaa_
    complexed with gol, so4

Details for d1yaua_

PDB Entry: 1yau (more details), 2.4 Å

PDB Description: structure of archeabacterial 20s proteasome- pa26 complex
PDB Compounds: (A:) Proteasome alpha subunit

SCOPe Domain Sequences for d1yaua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yaua_ d.153.1.4 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
itvfspdgrlfqveyareavkkgstalgmkfangvllisdkkvrsrlieqnsiekiqlid
dyvaavtsglvadarvlvdfarisaqqekvtygslvnienlvkrvadqmqqytqyggvrp
ygvslifagidqigprlfdcdpagtineykataigsgkdavvsflereykenlpekeavt
lgikalkssleegeelkapeiasitvgnkyriydqeevkkfl

SCOPe Domain Coordinates for d1yaua_:

Click to download the PDB-style file with coordinates for d1yaua_.
(The format of our PDB-style files is described here.)

Timeline for d1yaua_: