Lineage for d1yaus_ (1yau S:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700032Superfamily a.24.8: Proteasome activator [47216] (1 family) (S)
  5. 2700033Family a.24.8.1: Proteasome activator [47217] (3 proteins)
  6. 2700046Protein automated matches [190828] (1 species)
    not a true protein
  7. 2700047Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [188131] (7 PDB entries)
  8. 2700065Domain d1yaus_: 1yau S: [144626]
    Other proteins in same PDB: d1yaua_, d1yaub_, d1yauc_, d1yaud_, d1yaue_, d1yauf_, d1yaug_, d1yauh_, d1yaui_, d1yauj_, d1yauk_, d1yaul_, d1yaum_, d1yaun_
    automated match to d1ya7o1
    complexed with gol, so4

Details for d1yaus_

PDB Entry: 1yau (more details), 2.4 Å

PDB Description: structure of archeabacterial 20s proteasome- pa26 complex
PDB Compounds: (S:) proteasome activator protein PA26

SCOPe Domain Sequences for d1yaus_:

Sequence, based on SEQRES records: (download)

>d1yaus_ a.24.8.1 (S:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgsvdaesgktkggsqspslllel
rqidadfmlkvelatthlstmvravinayllnwkkliqprtgsdhmvs

Sequence, based on observed residues (ATOM records): (download)

>d1yaus_ a.24.8.1 (S:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
kraaliqnlrdsytetssfavieewaagtlqeiegiakaaaeahgvirnstygraqaeks
peqllgvlqryqdlchnvycqaetirtviairipehkeednlgvavqhavlkiideleik
tlgsgeksgsggaptpigmyalreylsarstvedkllgggsqspslllelrqidadfmlk
velatthlstmvravinayllnwkkliqprtgsdhmvs

SCOPe Domain Coordinates for d1yaus_:

Click to download the PDB-style file with coordinates for d1yaus_.
(The format of our PDB-style files is described here.)

Timeline for d1yaus_: