Lineage for d1y9kd1 (1y9k D:1-151)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731169Protein IAA acetyltransferase [143696] (1 species)
    YvbK ortholojg
  7. 731170Species Bacillus cereus [TaxId:1396] [143697] (1 PDB entry)
  8. 731174Domain d1y9kd1: 1y9k D:1-151 [122782]
    automatically matched to 1Y9K A:1-152

Details for d1y9kd1

PDB Entry: 1y9k (more details), 2.39 Å

PDB Description: IAA acetyltransferase from Bacillus cereus ATCC 14579
PDB Compounds: (D:) IAA acetyltransferase

SCOP Domain Sequences for d1y9kd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9kd1 d.108.1.1 (D:1-151) IAA acetyltransferase {Bacillus cereus [TaxId: 1396]}
msvvieripkeaipkslllladpserqiatyvqrgltyvakqggsvigvyvlletrpktm
eimniavaehlqgkgigkkllrhavetakgygmsklevgtgnssvsqlalyqkcgfrifs
idfdyfskhyeeeiiengivcrdmirlamel

SCOP Domain Coordinates for d1y9kd1:

Click to download the PDB-style file with coordinates for d1y9kd1.
(The format of our PDB-style files is described here.)

Timeline for d1y9kd1: