Lineage for d1y9kd2 (1y9k D:1-151)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. Protein automated matches [190241] (13 species)
    not a true protein
  7. Species Bacillus cereus [TaxId:226900] [188130] (1 PDB entry)
  8. Domain d1y9kd2: 1y9k D:1-151 [122782]
    Other proteins in same PDB: d1y9ka1, d1y9ka2, d1y9kb3, d1y9kd3
    automated match to d1y9ka1

Details for d1y9kd2

PDB Entry: 1y9k (more details), 2.39 Å

PDB Description: IAA acetyltransferase from Bacillus cereus ATCC 14579
PDB Compounds: (D:) IAA acetyltransferase

SCOPe Domain Sequences for d1y9kd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9kd2 d.108.1.1 (D:1-151) automated matches {Bacillus cereus [TaxId: 226900]}
msvvieripkeaipkslllladpserqiatyvqrgltyvakqggsvigvyvlletrpktm
eimniavaehlqgkgigkkllrhavetakgygmsklevgtgnssvsqlalyqkcgfrifs
idfdyfskhyeeeiiengivcrdmirlamel

SCOPe Domain Coordinates for d1y9kd2 are not available.

Timeline for d1y9kd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1y9kd3
View in 3D
Domains from other chains:
(mouse over for more information)
d1y9ka1, d1y9ka2, d1y9kb2, d1y9kb3, d1y9kc_