Lineage for d1y9kc_ (1y9k C:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533562Protein automated matches [190241] (12 species)
    not a true protein
  7. 2533569Species Bacillus cereus [TaxId:226900] [188130] (1 PDB entry)
  8. 2533571Domain d1y9kc_: 1y9k C: [122781]
    Other proteins in same PDB: d1y9ka1, d1y9ka2, d1y9kb3, d1y9kd3
    automated match to d1y9ka1

Details for d1y9kc_

PDB Entry: 1y9k (more details), 2.39 Å

PDB Description: IAA acetyltransferase from Bacillus cereus ATCC 14579
PDB Compounds: (C:) IAA acetyltransferase

SCOPe Domain Sequences for d1y9kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9kc_ d.108.1.1 (C:) automated matches {Bacillus cereus [TaxId: 226900]}
svvieripkeaipkslllladpserqiatyvqrgltyvakqggsvigvyvlletrpktme
imniavaehlqgkgigkkllrhavetakgygmsklevgtgnssvsqlalyqkcgfrifsi
dfdyfskhyeeeiiengivcrdmirlamel

SCOPe Domain Coordinates for d1y9kc_:

Click to download the PDB-style file with coordinates for d1y9kc_.
(The format of our PDB-style files is described here.)

Timeline for d1y9kc_: