PDB entry 1y9k

View 1y9k on RCSB PDB site
Description: IAA acetyltransferase from Bacillus cereus ATCC 14579
Class: transferase
Keywords: structural genomics, Midwest Center for Structural Genomics (MCSG), Bacillus cereus ATCC 14579, IAA acetyltransferase, acetyltransferase, PSI, Protein Structure Initiative, TRANSFERASE
Deposited on 2004-12-15, released 2005-02-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.39 Å
R-factor: 0.2
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: IAA acetyltransferase
    Species: Bacillus cereus ATCC 14579 [TaxId:226900]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81FK8 (2-End)
      • modified residue (2)
      • modified residue (61)
      • modified residue (64)
      • modified residue (94)
      • modified residue (145)
      • modified residue (150)
      • cloning artifact (2)
    Domains in SCOPe 2.08: d1y9ka1, d1y9ka2
  • Chain 'B':
    Compound: IAA acetyltransferase
    Species: Bacillus cereus ATCC 14579 [TaxId:226900]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81FK8 (2-End)
      • cloning artifact (0-1)
      • modified residue (2)
      • modified residue (61)
      • modified residue (64)
      • modified residue (94)
      • modified residue (145)
      • modified residue (150)
      • modified residue (0)
      • cloning artifact (2)
    Domains in SCOPe 2.08: d1y9kb2, d1y9kb3
  • Chain 'C':
    Compound: IAA acetyltransferase
    Species: Bacillus cereus ATCC 14579 [TaxId:226900]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81FK8
      • modified residue (61)
      • modified residue (64)
      • modified residue (94)
      • modified residue (145)
      • modified residue (150)
    Domains in SCOPe 2.08: d1y9kc_
  • Chain 'D':
    Compound: IAA acetyltransferase
    Species: Bacillus cereus ATCC 14579 [TaxId:226900]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q81FK8 (2-End)
      • cloning artifact (0-1)
      • modified residue (2)
      • modified residue (61)
      • modified residue (64)
      • modified residue (94)
      • modified residue (145)
      • modified residue (150)
      • modified residue (0)
      • cloning artifact (2)
    Domains in SCOPe 2.08: d1y9kd2, d1y9kd3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y9kA (A:)
    namsvvieripkeaipkslllladpserqiatyvqrgltyvakqggsvigvyvlletrpk
    tmeimniavaehlqgkgigkkllrhavetakgygmsklevgtgnssvsqlalyqkcgfri
    fsidfdyfskhyeeeiiengivcrdmirlamelnknv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9kA (A:)
    msvvieripkeaipkslllladpserqiatyvqrgltyvakqggsvigvyvlletrpktm
    eimniavaehlqgkgigkkllrhavetakgygmsklevgtgnssvsqlalyqkcgfrifs
    idfdyfskhyeeeiiengivcrdmirlameln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y9kB (B:)
    namsvvieripkeaipkslllladpserqiatyvqrgltyvakqggsvigvyvlletrpk
    tmeimniavaehlqgkgigkkllrhavetakgygmsklevgtgnssvsqlalyqkcgfri
    fsidfdyfskhyeeeiiengivcrdmirlamelnknv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9kB (B:)
    namsvvieripkeaipkslllladpserqiatyvqrgltyvakqggsvigvyvlletrpk
    tmeimniavaehlqgkgigkkllrhavetakgygmsklevgtgnssvsqlalyqkcgfri
    fsidfdyfskhyeeeiiengivcrdmirlameln
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y9kC (C:)
    namsvvieripkeaipkslllladpserqiatyvqrgltyvakqggsvigvyvlletrpk
    tmeimniavaehlqgkgigkkllrhavetakgygmsklevgtgnssvsqlalyqkcgfri
    fsidfdyfskhyeeeiiengivcrdmirlamelnknv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9kC (C:)
    svvieripkeaipkslllladpserqiatyvqrgltyvakqggsvigvyvlletrpktme
    imniavaehlqgkgigkkllrhavetakgygmsklevgtgnssvsqlalyqkcgfrifsi
    dfdyfskhyeeeiiengivcrdmirlamel
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y9kD (D:)
    namsvvieripkeaipkslllladpserqiatyvqrgltyvakqggsvigvyvlletrpk
    tmeimniavaehlqgkgigkkllrhavetakgygmsklevgtgnssvsqlalyqkcgfri
    fsidfdyfskhyeeeiiengivcrdmirlamelnknv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9kD (D:)
    namsvvieripkeaipkslllladpserqiatyvqrgltyvakqggsvigvyvlletrpk
    tmeimniavaehlqgkgigkkllrhavetakgygmsklevgtgnssvsqlalyqkcgfri
    fsidfdyfskhyeeeiiengivcrdmirlamel