![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, beta-chain [46500] (26 species) |
![]() | Species Horse (Equus caballus) [TaxId:9796] [46504] (19 PDB entries) |
![]() | Domain d1y8kb_: 1y8k B: [122754] Other proteins in same PDB: d1y8ka_, d1y8kc_ automated match to d1g0bb_ complexed with hem |
PDB Entry: 1y8k (more details), 2.3 Å
SCOPe Domain Sequences for d1y8kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y8kb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Horse (Equus caballus) [TaxId: 9796]} vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk dftpelqasyqkvvagvanalahkyh
Timeline for d1y8kb_: