Class a: All alpha proteins [46456] (290 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, alpha-chain [46486] (24 species) |
Species Horse (Equus caballus) [TaxId:9796] [46488] (19 PDB entries) |
Domain d1y8ka_: 1y8k A: [122753] Other proteins in same PDB: d1y8kb_, d1y8kd_ automated match to d1g0ba_ complexed with hem |
PDB Entry: 1y8k (more details), 2.3 Å
SCOPe Domain Sequences for d1y8ka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y8ka_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Horse (Equus caballus) [TaxId: 9796]} vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa vhasldkflssvstvltskyr
Timeline for d1y8ka_: