SCOPe 2.01: Domain d1y4jb_: 1y4j B:

Lineage for d1y4jb_ (1y4j B:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.7: Sulfatase-modifying factor-like [143959] (3 proteins)
   Pfam PF03781 (DUF323); fold decorated with many additional structures; C-alpha-formyglycine-generating enzyme

6. Protein Sulfatase modifying factor 2 [143962] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143963] (1 PDB entry)
   Uniprot Q8NBJ7 28-294

8. Domain d1y4jb_: 1y4j B: [122621]
   automated match to d1y4ja1
   complexed with ca, mpd

Details for d1y4jb_

PDB Entry: 1y4j, 1.86 Å

PDB Description: crystal structure of the paralogue of the human formylglycine generating enzyme

PDB Compounds: (B:) Sulfatase modifying factor 2

SCOPe Domain Sequences for d1y4jb_:

Sequence; same for both SEQRES and ATOM records:

>d1y4jb_ d.169.1.7 (B:) Sulfatase modifying factor 2 {Human (Homo sapiens) [TaxId: 9606]}
atsmvqlqggrflmgtnspdsrdgegpvreatvkpfaidifpvtnkdfrdfvrekkyrte
aemfgwsfvfedfvsdelrnkatqpmksvlwwlpvekafwrqpagpgsgirerlehpvlh
vswndaraycawrgkrlpteeewefaargglkgqvypwgnwfqpnrtnlwqgkfpkgdka
edgfhgvspvnafpaqnnyglydllgnvwewtaspyqaaeqdmrvlrgaswidtadgsan
hrarvttrmgntpdsasdnlgfrcaada

Timeline for d1y4jb_:

• d1y4jb_ first appeared in SCOP 1.73, called d1y4jb1
  
• d1y4jb_ was called d1y4jb1 in SCOP 1.75
  
• d1y4jb_ appears in SCOPe 2.02
  
• d1y4jb_ appears in the current release, SCOPe 2.08