SCOP 1.73: Domain d1y4jb1: 1y4j B:28-294

Lineage for d1y4jb1 (1y4j B:28-294)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (8 families)

5. Family d.169.1.7: Sulfatase-modifying factor-like [143959] (2 proteins)
   Pfam PF03781 (DUF323); fold decorated with many additional structures; C-alpha-formyglycine-generating enzyme

6. Protein Sulfatase modifying factor 2 [143962] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [143963] (1 PDB entry)

8. Domain d1y4jb1: 1y4j B:28-294 [122621]
   automatically matched to 1Y4J A:28-294
   complexed with ca, fuc, mpd, nag

Details for d1y4jb1

PDB Entry: 1y4j, 1.86 Å

PDB Description: crystal structure of the paralogue of the human formylglycine generating enzyme

PDB Compounds: (B:) Sulfatase modifying factor 2

SCOP Domain Sequences for d1y4jb1:

Sequence; same for both SEQRES and ATOM records:

>d1y4jb1 d.169.1.7 (B:28-294) Sulfatase modifying factor 2 {Human (Homo sapiens) [TaxId: 9606]}
tsmvqlqggrflmgtnspdsrdgegpvreatvkpfaidifpvtnkdfrdfvrekkyrtea
emfgwsfvfedfvsdelrnkatqpmksvlwwlpvekafwrqpagpgsgirerlehpvlhv
swndaraycawrgkrlpteeewefaargglkgqvypwgnwfqpnrtnlwqgkfpkgdkae
dgfhgvspvnafpaqnnyglydllgnvwewtaspyqaaeqdmrvlrgaswidtadgsanh
rarvttrmgntpdsasdnlgfrcaada

Timeline for d1y4jb1:

• d1y4jb1 is new in SCOP 1.73
  
• d1y4jb1 appears in SCOP 1.75
  
• d1y4jb1 appears in the current release, SCOPe 2.08, called d1y4jb_