Lineage for d1y4jb_ (1y4j B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002237Family d.169.1.7: Sulfatase-modifying factor-like [143959] (3 proteins)
    Pfam PF03781 (DUF323); fold decorated with many additional structures; C-alpha-formyglycine-generating enzyme
  6. 3002243Protein Sulfatase modifying factor 2 [143962] (1 species)
  7. 3002244Species Human (Homo sapiens) [TaxId:9606] [143963] (1 PDB entry)
    Uniprot Q8NBJ7 28-294
  8. 3002246Domain d1y4jb_: 1y4j B: [122621]
    automated match to d1y4ja1
    complexed with ca, mpd

Details for d1y4jb_

PDB Entry: 1y4j (more details), 1.86 Å

PDB Description: crystal structure of the paralogue of the human formylglycine generating enzyme
PDB Compounds: (B:) Sulfatase modifying factor 2

SCOPe Domain Sequences for d1y4jb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y4jb_ d.169.1.7 (B:) Sulfatase modifying factor 2 {Human (Homo sapiens) [TaxId: 9606]}
atsmvqlqggrflmgtnspdsrdgegpvreatvkpfaidifpvtnkdfrdfvrekkyrte
aemfgwsfvfedfvsdelrnkatqpmksvlwwlpvekafwrqpagpgsgirerlehpvlh
vswndaraycawrgkrlpteeewefaargglkgqvypwgnwfqpnrtnlwqgkfpkgdka
edgfhgvspvnafpaqnnyglydllgnvwewtaspyqaaeqdmrvlrgaswidtadgsan
hrarvttrmgntpdsasdnlgfrcaada

SCOPe Domain Coordinates for d1y4jb_:

Click to download the PDB-style file with coordinates for d1y4jb_.
(The format of our PDB-style files is described here.)

Timeline for d1y4jb_: