Class a: All alpha proteins [46456] (290 folds) |
Fold a.238: BAR/IMD domain-like [116747] (1 superfamily) 6 helices, homodimer of 3-helical domains |
Superfamily a.238.1: BAR/IMD domain-like [103657] (5 families) core: dimeric six-helical bundle; protuding long helices form aniparallel coiled coils at both bundle ends |
Family a.238.1.3: IMD domain [140703] (1 protein) Pfam PF08397 |
Protein BAP2/IRSp53 N-terminal domain [140704] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [140705] (3 PDB entries) Uniprot Q9UQB8 1-248! Uniprot Q9UQB8 2-228 |
Domain d1y2oa1: 1y2o A:1-248 [122573] |
PDB Entry: 1y2o (more details), 2.2 Å
SCOPe Domain Sequences for d1y2oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1y2oa1 a.238.1.3 (A:1-248) BAP2/IRSp53 N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} mslsrseemhrltenvyktimeqfnpslrnfiamgknyekalagvtyaakgyfdalvkmg elasesqgskelgdvlfqmaevhrqiqnqleemlksfhnelltqleqkveldsrylsaal kkyqteqrskgdaldkcqaelkklrkksqgsknpqkysdkelqyidaisnkqgelenyvs dgyktalteerrrfcflvekqcavaknsaayhskgkellaqklplwqqacadpskipera vqlmqqva
Timeline for d1y2oa1: